Loading...
Staff Review Agenda Package 16-Jun-26Tuesday, June 16, 2026 6:00 PM Union County, NC Union County Government Center 500 North Main Street Monroe, North Carolina Meeting Agenda Board Room, First Floor Board of Commissioners Chair Brian Helms Vice Chair Christina Helms Commissioner Clancy Baucom Commissioner Melissa Merrell Commissioner Errol Wedra 1 Board of Commissioners Meeting Agenda June 16, 2026 Closed Session - 5:15 PM Opening of Meeting - 6:00 PM Invocation - Commissioner Melissa Merrell Pledge of Allegiance Informal Comments Public Hearing(s) Public Hearing - Rezoning Petition 2026-CZ-007 Beulah Church26-320 INFORMATION CONTACT: Bjorn E. Hansen, Planning Department, Senior Planner - Long Range Planning, 704-283-3690 ACTION REQUESTED: Conduct public hearing for rezoning petition PRIOR BOARD ACTIONS: None BACKGROUND: This case is a request to rezone a 3.21 acre parcel appearing on the tax map as tax parcel 06-042-001J located on Beulah Church Road from B-2 with Conditions to B-2 with Modified Conditions. The rezoning request is an amendment to an existing conditional rezoning on the site and includes the following amended conditions : 1)Hours of operation changed from 9:00 AM to 9:00 PM to 6:30 AM to 9:30 PM 2)Any required privacy fence will be made of solid material to reduce noise 3)Trash and recycling pickup will occur between 9:00 AM and 5:00 PM The second and third conditions were added by the Land Use Board at its May 19, 2026 meeting as a response to resident concerns over noise . These additional conditions were agreed to by the applicant . The Land Use Board then recommended approval on a 7-0 vote, citing consistency with the land use map used in the initial rezoning and increased flexibility for the owner. If the Board of Commissioners wishes to make a decision on this rezoning petition, it can consider the following motions . To approve the proposed amendment (the proposal is consistent with the current plan) Motion (i) Adopt the Ordinance Approving Revision to the Official Zoning Map of Union County, North Carolina, and (ii) adopt the consistency and Page 1 of 16 2 Board of Commissioners Meeting Agenda June 16, 2026 reasonableness statement for approval . To deny the proposed amendment (the proposal is inconsistent with the current plan) Motion (i) Deny rezoning petition CZ-2026-007 submitted by R. Dean Harrell; and (ii) adopt the consistency and reasonableness statement for denial . FINANCIAL IMPACT: None Public Hearing - Rezoning Petition 2026-CZ-005 McAteer26-321 INFORMATION CONTACT: Bjorn E. Hansen, Planning Department, Senior Planner - Long Range Planning, 704-283-3690 ACTION REQUESTED: Conduct public hearing for proposed rezoning PRIOR BOARD ACTIONS: None BACKGROUND: This case is a request to rezone a 5.75 acre portion of a 17.21 acre parcel appearing on the tax map as tax parcel 09-384-013 located on South Rocky River Road from RA-40 to Light Industrial (LI) with Conditions. The rezoning request is a conditional rezoning, and includes the following conditions: 1)Limited to approved site plan dated April 6, 2026 2)Uses limited to office, warehouse and construction equipment and material storage 3)5.75 acre portion will be subdivided from parcel 4)Five-year vesting of development rights 5)Development will meet all requirements of the Union County Unified Development Ordinance on the date of approval The Land Use Board unanimously recommended approval at its May 19, 2026 meeting, citing consistency with the Land Use Map and increased business opportunities. If the Board of Commissioners wishes to make a decision on this rezoning petition, it can consider the following motions : To approve the proposed amendment (the proposal is consistent with the current plan) Motion (i) Adopt the Ordinance Approving Revision to the Official Zoning Map of Union County, North Carolina, and (ii) adopt the consistency and reasonableness statement for approval . To deny the proposed amendment (the proposal is inconsistent with the current plan) Motion Page 2 of 16 3 Board of Commissioners Meeting Agenda June 16, 2026 (i) Deny rezoning petition CZ-2026-005 from Jeremy McAteer; and (ii) adopt the consistency and reasonableness statement for denial . FINANCIAL IMPACT: None Public Hearing - Conveyance of County Owned Property in Union County Industrial Park (Project Canopy) 26-335 INFORMATION CONTACT: Ron Mahle, Economic Development, Director, 980-476-5279 ACTION REQUESTED: Conduct a Public Hearing to consider the conveyance of 60.97 acres located within the Union County Industrial Park along Goldmine Road to McGee Corporation, their subsidiary or affiliated entity, for a new industrial facility. PRIOR BOARD ACTIONS: 1) October 20, 2025, Regular Meeting, Agenda Item #25-624 - Public Hearing Conducted for consideration of Step 4 Economic Development Incentive Grant to McGee Corporation 2) October 20, 2025, Regular Meeting, Agenda Item #25-626 - Step 4 Economic Development Incentive Grant was awarded to McGee Corporation in an amount-not-to-exceed $696,00 paid over a 5-year period beginning in FY 2028 3) December 8, 2025, Regular Meeting, Agenda Item #25-748 - Public Hearing for consideration of conveyance of county owned property 4) December 8, 2025, Regular Meeting, Agenda Item #25-749 - Consideration of conveyance of county owned property . BACKGROUND: The Union County Economic Development Department started conversations with McGee Corporation under codename Project Canopy in late 2024 about the potential relocation of their manufacturing operation from Stallings, North Carolina, to a 60.97-acre parcel located off Goldmine Road. The company has previously submitted an offer of $4,267,900.00 , being $70,000 per acre. However, there are certain conditions existing on the land, which has reduced this offer to $4,136,650.00. The land sought by the company was previously acquired by Union County for an industrial park or to be held for resale for industrial or commercial use, for an industrial or commercial project, pursuant to G.S. 158-7.1 (the specific parcel considered for sale is Union County Tax Parcel #09372003D). McGee Corporation’s purchase of this land is in concert with the County ’s economic development objectives, which are the stimulation of the local economy, growth of the tax base, promotion of business, and creation of job opportunities within Union County. The purchase consideration is $4,136,650.00 in cash, subject to all easements, right of ways, encroachments, and other restrictions of record. The Board of Commissioners has determined that the property subject to conveyance, with consideration of certain conditions existing on the land, has a fair market value of $4,136,650.00. Page 3 of 16 4 Board of Commissioners Meeting Agenda June 16, 2026 The land will be used for an industrial project with an approximate investment of $40,000,000 and the creation of 35 new jobs with a probable hourly wage of $30.28 per hour for employees on the property . McGee Corporation intends to build a new 366,000 square-foot manufacturing facility on the property which will serve as its headquarters for design, sales, manufacturing, and distribution . This sale is made pursuant to private negotiation under G .S. 158-7.1 FINANCIAL IMPACT: Union County would receive $4,136,650.00 in cash in exchange for the land. The project would also bring a prospective $40,000,000 in new capital investment and at least 35 new jobs earning a probable wage of $30.28 per hour into Union County. Staff Recognition Service Award Recognition26-339 INFORMATION CONTACT: Jennifer Davis, Human Resources, Assistant Director, 704-283-3803 ACTION REQUESTED: Short video will play to recognize employee service award recipients for Q2 including April, May, and June . PRIOR BOARD ACTIONS: None. BACKGROUND: The employee recognition program acknowledges employees for full-time continuous service at the following intervals : 5 years, 10 years, 15 years, 20 years, 25 years and 30 years of service. We would like to recognize the following employees for full-time continuous service with Union County Local Government. FINANCIAL IMPACT: None. Consent Agenda Write Off - FY26 Water & Sewer Delinquent Balances26-345 INFORMATION CONTACT: Amy McCaskill, UC Water - Utility Business Services, Director, 704-283-3508 ACTION REQUESTED: Approve the write-off of uncollectible water and sewer accounts as needed. PRIOR BOARD ACTIONS: None. BACKGROUND: Page 4 of 16 5 Board of Commissioners Meeting Agenda June 16, 2026 N.C.G.S 25-2-725(1) and 1-52(1) place a statute of limitations on how far back delinquent water, sewer, and solid waste account balances can be collected. Water accounts can be collected up to 4 years past their final bill date while sewer accounts can only be collected up to 3 years past their final bill date. Any outstanding account balances past those dates are considered to be write-offs defined as the elimination of uncollectible accounts receivable recorded on the general ledger . The included attachment, for 1,139 water and sewer accounts totaling $157,526.65 denotes the information for FY 2026. FINANCIAL IMPACT: There will be a reduction in the accounts receivable balances for Union County Water of $157,526.65. This will also be shown as a corresponding expense to the enterprise fund uncollectable accounts . Financing Letter - New Salem Volunteer Fire Department26-326 INFORMATION CONTACT: Patrick Niland, County Manager ’s Office, Deputy County Manager, 704-283-3630 ACTION REQUESTED: Authorize Chairman of the Board to sign the attached letter . PRIOR BOARD ACTIONS: None. BACKGROUND: The New Salem Volunteer Fire Department is constructing a new fire station. The Fire Department has secured financing agreement with HomeTrust Bank. As part of the financing documents, the bank requires a letter from Union County, signed by the chair, stating that New Salem Volunteer Fire Department is allowed to provide fire service in Union County, they are in good standing, the fire tax district supports fire operations, and that the department has made the county aware of this financing agreement. FINANCIAL IMPACT: None. Contract Renewal - Uninterrupted Power Supply Maintenance26-347 INFORMATION CONTACT: Vicki Callicutt, Emergency Communications, Director, 704-283-3550 ACTION REQUESTED: Authorize the County Manager to 1) negotiate and execute an agreement substantially consistent with this agenda item, 2) exercise any renewal or extension term options set forth in the Agreement, and 3) terminate the Agreement if deemed in the best interest of the County, each in the County Manager's discretion . PRIOR BOARD ACTIONS: None. BACKGROUND: Page 5 of 16 6 Board of Commissioners Meeting Agenda June 16, 2026 Emergency Communications maintains a backup dispatch center at the Government Center and has equipment that requires regular maintenance to ensure uninterrupted operability of 911 operations for Union County agencies and citizens . The Emergency Communications Department has utilized the contractual services of Vertiv Corporation for Uninterrupted Power Supply Maintenance since July 2022. Vertiv Corporation has been effective and efficient in meeting our service needs, and we are requesting to continue this service for an additional year. FINANCIAL IMPACT: The anticipated annual cost for this service is $13,844.26. Funding is available in the adopted FY2026 budget with future expenditures subject to annual BOCC budget appropriation . Grant Application - Sisters of Mercy of North Carolina Legacy26-333 INFORMATION CONTACT: Jason May, Budget & Grants Management, Director, 704-283-3760 ACTION REQUESTED: Authorize the County Manager to submit the associated grant application and make necessary assurances and certifications associated with the grant application as substantially consistent with this agenda item, which includes the authorization to execute documents related to award of the grant and budget funds as appropriate . PRIOR BOARD ACTIONS: None. BACKGROUND: The Parenting Support & Nurturing Parenting Program (PSNP) helps families strengthen parenting skills and build healthy, supportive relationships with their children. The program provides intensive parenting education and support services to families experiencing significant parenting challenges, including those at risk of or in the early stages of child maltreatment who may benefit from intervention and treatment services. Established in Union County in 2011, PSNP is funded through the Alliance for Children. Union County has been advised to anticipate a 10% reduction in funding from the Alliance for Children for FY 2027. This grant request is intended to help offset the anticipated funding shortfall and ensure the continuation of this essential program and the services it provides to vulnerable families in the community . The Sisters of Mercy of North Carolina Legacy awards grants to tax-exempt health care, educational, and social service organizations that align with its mission of improving the quality of life for women, children, older adults, and individuals experiencing poverty . The organization prioritizes funding for ongoing operational needs as well as specific program and project expenses that directly support these populations . Page 6 of 16 7 Board of Commissioners Meeting Agenda June 16, 2026 FINANCIAL IMPACT: The grant request will be for approximately $20,000. There is no match required for this grant. NC Department of Public Safety Juvenile Crime Prevention Council Funding Plan FY 2026-2027 26-323 INFORMATION CONTACT: Beverly Liles, Finance, Director, 704-283-3675 ACTION REQUESTED: 1) Approve County Funding Allocation Plan, Annual Plan and Certification for FY 2026-2027, 2) authorize the Finance Director to approve the grant agreements and documents related to such grant agreements during their term, and 3) authorize the County Manager to appropriate JCPC Funding as approved in the funding plan by a County Manager's Budget Amendment in FY 2027. PRIOR BOARD ACTIONS: None BACKGROUND: The Juvenile Crime Prevention Council (JCPC) is a Board appointed by Commissioners, as defined by State Statutes . The JCPC provides funding and monitors Community Based alternatives to juvenile incarceration and provides funding for substance abuse prevention strategies and programs. Funding for JCPC programs is generally adopted in the State Budget and assigned to County programs by a formula grant . Normally, a county JCPC approves a budget for the upcoming fiscal year, which is then submitted to the North Carolina Department of Public Safety Juvenile Justice and Delinquency Prevention (the DJJ). The attached funding plan was developed and approved by the JCPC Board and represents the Board's plan for how the funds will be spent for the 2026-2027 fiscal year. This request will be included in the State ’s DJJ budget which is planned for 2026-2027. The JCPC Board approved $476,439 for County programs for the 2026-2027 fiscal year. The Funding Plan allocates funding from the State to the following programs : Life Connections D-A-S-H Counseling Services $100,000, Transforming Youth Movement-Transforming Futures $125,000, Transforming Youth Movement- Union County Teen Court Program $40,790, Aspire Youth and Family Kids at Work $75,312, JCPC Administration $9,502, Arts Related Innovative Student Empowerment (ARISE) Union-KRE8IVU $50,000, The Connection Center $45,835, and New Covenant Community Development Center - Next Step Youth Program $30,000. The JCPC budget is normally approved as a "pass through" line item in the County budget, meaning that the amount approved by the State is Page 7 of 16 8 Board of Commissioners Meeting Agenda June 16, 2026 received by the County and then used for the JCPC program . Union County has not approved JCPC programs in line-item detail in the past; rather, the JCPC Board normally negotiates, approves, and monitors line-item detail within the amount of funds allocated to the program, and provides a recommended budget to Commissioners . FINANCIAL IMPACT: None 2026 Union County Jail Bond Referendum Introduction of Bond Orders and Call for Public Hearing 26-329 INFORMATION CONTACT: Beverly Liles, Finance, Director, 704-283-3675 ACTION REQUESTED: 1) Introduce Bond Order Authorizing the Issuance $200,000,000 General Obligation Jail Bonds of the County of Union, North Carolina, 2) Adopt Resolution of the County of Union, North Carolina Regarding Bond Order Authorizing the Issuance of General Obligation Jail Bonds, Setting Public Hearing Thereon and Directing Publication of Notice of Said Public Hearing. PRIOR BOARD ACTIONS: 1) May 18, 2026, Regular Meeting, Agenda Item #26-266 - The Board adopted Resolution of the Board of Commissioners of the County of Union, North Carolina directing the Publication of Notice of Intention to apply to the Local Government Commission for approval of $200,000,000 General Obligation Jail Bonds and adopted resolution making Certain statements of facts concerning the proposed jail bond issue and authorizing the application to the Local Government Commission for $200,000,000 of general obligation jail bonds. 2) April 20, 2026, Regular Meeting, Agenda Item #26-212 - The Board authorized staff to move forward with the necessary steps for a 2026 Bond Referendum to fund a new jail facility in the amount of $200,000,000. BACKGROUND: General Obligations Bonds (GO) are widely considered the lowest-interest, most cost-effective financing mechanism for long-term capital projects in North Carolina due to the pledge of the local government's full faith, credit, and taxing power . For North Carolina counties, which are legally required to provide secure, safe, and sanitary inmate housing, financing a jail through a GO bond ensures that the borrowing costs are minimized for the taxpayers, as these bonds typically secure better credit ratings than other debt options . The GO bond process is more rigorous than other financing options (requiring a public vote), however the interest savings from a GO bond make it the preferred tool for construction of a new jail . Page 8 of 16 9 Board of Commissioners Meeting Agenda June 16, 2026 The Introduction of the Bond Order lays out the purpose of the general obligation bond referendum that will be placed on the November 3, 2026 election ballot and the Resolution will set the date for the Public Hearing required on July 20, 2026 and authorize the Clerk to the Board to publish the notice of the Public Hearing. FINANCIAL IMPACT: The estimated cumulative cost over the life of the bond, using the highest interest rate of 5.344% charged for similar debt over the last twenty years is estimated at $312,224,000. The estimated maximum annual debt service payment is $20,688,000 beginning in FY 2028 and commencing in FY 2047. The annual estimated amount of property tax liability increases for each $100,000 of property tax value to service the cumulative cost over the life of the bond is estimated at $31.10. The annual estimated amount of property tax liability increases for each $400,000 of property tax value to service the cumulative cost over the life of the bond is estimated at $124.40 (based on 3.11¢ increase in the ad valorem property tax rate). These estimates are based on the legislative requirements of NC Session Law 2022-53 for bond referendums. Authorization to Write Off Returned or Uncollectible Revenues26-344 INFORMATION CONTACT: Beverly L. Liles, Finance, Director, 704-283-3675 ACTION REQUESTED: Approve the write-off of returned or uncollectible revenues totaling $695.32. PRIOR BOARD ACTIONS: None. BACKGROUND: The Finance Department has conducted a review of outstanding returned revenues, including non-sufficient funds (NSF) checks. After reasonable and diligent efforts to collect these funds, the department has determined that these amounts are not recoverable . Accordingly, we are requesting Board approval to formally write off these amounts from the County’s financial records. FINANCIAL IMPACT: The total amount to be written off is $695.32. These funds have previously been recorded but are now deemed uncollectible . No additional budget appropriation is required . April 2026 NCVTS Motor Vehicle Tax Report26-324 INFORMATION CONTACT: Vann Harrell, Tax Administration, Tax Administrator, 704-283-3748; Kristen Foxworth, Tax Administration, Deputy Tax Administrator, 704-283-3591 ACTION REQUESTED: Approve the April 2026 NCVTS Motor Vehicle Tax Refund Report . Page 9 of 16 10 Board of Commissioners Meeting Agenda June 16, 2026 PRIOR BOARD ACTIONS: None. BACKGROUND: The refunds included in this report represent adjustments made to tax bills that resulted in refunds of motor vehicle taxes paid under the Tax and Tag Together program operated jointly between the counties and the State. FINANCIAL IMPACT: $1,579.07 Contract Renewal - Microsoft Enterprise Agreement26-348 INFORMATION CONTACT: Jon Amelio, Information Technology, Director, 704-283-3533 ACTION REQUESTED: Authorize the County Manager to 1) negotiate and execute an agreement substantially consistent with this agenda item, 2) exercise any renewal or extension term options set forth in the Agreement, and 3) terminate the Agreement if deemed in the best interest of the County, each in the County Manager's discretion . PRIOR BOARD ACTIONS: None BACKGROUND: This is the County's Enterprise Agreement Renewal for Microsoft . This contract covers all aspects of our Microsoft Cloud and on-premises environment, from user subscriptions to back-end server maintenance and SQL Server clustering. FINANCIAL IMPACT: Price to be determined after June 1st on forthcoming quote . Need on agenda for June 16th. Resolution - Updates to the Union County Personnel Resolution26-349 INFORMATION CONTACT: Julie Broome, Human Resources, Director, 704-283-3869 ACTION REQUESTED: Adopt the revised Union County Personnel Resolution, effective July 1, 2026. PRIOR BOARD ACTIONS: None. BACKGROUND: Updates to the Personnel Resolution are recommended at times to address terminology changes, organizational alignment, county management operational needs, and Board of County Commissioners direction. The recommended revised Union County Personnel Resolution (“UCPR”) includes the following revisions to the existing UCPR : ·Technical, terminology, and practical revisions throughout the UCPR to correspond with current terminology, organizational structure, Page 10 of 16 11 Board of Commissioners Meeting Agenda June 16, 2026 practice, and applicable law ·Clarification and streamlining of the County Manager ’s authority concerning department reorganizations ·Clarification and improvements concerning the administration of the pay plan in certain circumstances ·Updates to uniformed services (military) leave policy ·Added provisions to allow oral fluid (saliva) drug testing in certain circumstances FINANCIAL IMPACT: None. Minutes for Approval26-340 INFORMATION CONTACT: Lynn G. West, Clerk to the Board of Commissioners, 704-283-3853 ACTION REQUESTED: Approve minutes PRIOR BOARD ACTIONS: None BACKGROUND: Draft minutes have been provided to the Board for review and approval . FINANCIAL IMPACT: None Information Only Tax Collector’s Departmental Report for April 202626-325 INFORMATION CONTACT: Kristen Foxworth, Tax Administration, Deputy Tax Administrator, 704-283-3591 ACTION REQUESTED: None - Information Only. PRIOR BOARD ACTIONS: None. BACKGROUND: This report reflects the totals of all tax transactions within the Tax Collector’s Office for the month of April 2026 as required by NCGS 105-350(7). FINANCIAL IMPACT: None. Communications Monthly Report - May 202626-342 INFORMATION CONTACT: Liz Cooper, Public Communications, Director, 704-283-3587 ACTION REQUESTED: None - Information Only. Page 11 of 16 12 Board of Commissioners Meeting Agenda June 16, 2026 PRIOR BOARD ACTIONS: None. BACKGROUND: This report provides valuable metrics and insights into communication platforms and our efforts to collaborate with all County departments to inform and engage residents, promote programs and services, and strengthen internal and external communications . FINANCIAL IMPACT: None. Facilities Major Capital Projects Update - Quarterly Report26-346 INFORMATION CONTACT: Linda Whitaker, Assistant Director Design and Construction, Facilities & Fleet Management, 704-420-2626 ACTION REQUESTED: None - Information Only. PRIOR BOARD ACTIONS: None. BACKGROUND: This is the quarterly major capital projects update for projects managed by the Facilities & Fleet Management Department . FINANCIAL IMPACT: None. Drought Status - Update26-350 INFORMATION CONTACT: Aubrey Lofton, UC Water - Planning & Resource Management, Director, 704-296-4241 ACTION REQUESTED: None. PRIOR BOARD ACTIONS: None. BACKGROUND: Union County Water is closely following the current drought . Union County Water declared Stage 2 Drought Restrictions on May 15 to comply with the Catawba-Wateree Drought Management Advisory Group’s status change based on the Low Inflow Protocol triggers . Attached are the updated Low Inflow Protocol triggers as of June 1, 2026 and the US Drought Monitor as of June 4, 2026. FINANCIAL IMPACT: None. Business Consider Amendment to Conveyance of County Owned Property in Union County Industrial Park (Project Canopy) 26-336 Page 12 of 16 13 Board of Commissioners Meeting Agenda June 16, 2026 INFORMATION CONTACT: Ron Mahle, Economic Development, Director, 980-476-5279 ACTION REQUESTED: 1) Adopt the Resolution for the Conveyance of County Property to McGee Corporation for Economic Development Pursuant to N .C.G.S. §158-7.1; and 2) Authorize the County Manager to i) negotiate and execute any documentation and agreement substantially consistent with this agenda item and necessary to effectuate such sale, ii) exercise any extension term options set forth in the Agreement, and iii) terminate the Agreement if deemed in the best interest of the County, each in the County Manager’s discretion. PRIOR BOARD ACTIONS: 1) October 20, 2025, Regular Meeting, Agenda Item #25-624 - Public Hearing Conducted for consideration of Step 4 Economic Development Incentive Grant to McGee Corporation 2) October 20, 2025, Regular Meeting, Agenda Item #25-626 - Step 4 Economic Development Incentive Grant was awarded to McGee Corporation in an amount-not-to-exceed $696,00 paid over a 5-year period beginning in FY 2028 3) December 8, 2025, Regular Meeting, Agenda Item #25-748 - Public Hearing Conducted on conveyance of real property 4) December 8, 2025, Regular Meeting, Agenda Item #25-749 - Consideration of conveyance of county owned property BACKGROUND: The Union County Economic Development Department started conversations with McGee Corporation under codename Project Canopy in late 2024 about the potential relocation of their manufacturing operation from Stallings, North Carolina, to a 60.97-acre parcel located off Goldmine Road. The company originally submitted an offer of $4,267,900, being $70,000 per acre. The land sought by the company was previously acquired by Union County for an industrial park or to be held for resale for industrial or commercial use, for an industrial or commercial project, pursuant to G .S. 158-7.1(the specific parcel considered for sale is Union County Tax Parcel #09372003D). McGee Corporation’s purchase of this land is in concert with the County ’s economic development objectives, which are the stimulation of the local economy, growth of the tax base, promotion of business, and creation of job opportunities within Union County . The original Real Estate Purchase and Sale Agreement was signed on January 20, 2026, for the purchase price of $4,267,900. However, it was discovered that there exist certain conditions on approximately 2.5 acres of the property, including encroachments as well as wetlands, which have decreased the fair market value of the property and need to be addressed prior to the closing date. The price per acre has been reduced only on the affected 2.5 acres of the property. The purchase consideration is now $4,136,650.00 in cash, subject to all easements, right of ways, Page 13 of 16 14 Board of Commissioners Meeting Agenda June 16, 2026 encroachments, and other restrictions of record, and to account of any property conditions. The Board of Commissioners has determined that the property subject to conveyance has a fair market value of $4,136,650.00. The land will be used for an industrial project with an approximate investment of $40,000,000 and the creation of 35 new jobs with a probable hourly wage of $30.28 per hour for employees on the property . McGee Corporation intends to build a new 366,000 square-foot manufacturing facility on the property which will serve as its headquarters for design, sales, manufacturing, and distribution . This sale is made pursuant to private negotiation under G .S. 158-7.1. FINANCIAL IMPACT: Union County would receive $4,136,650.00 in cash in exchange for the land. The project would also bring a prospective $40,000,000 in new capital investment and at least 35 new jobs earning a probable wage of $30.28 per hour into Union County. 2025 Critical Intersection Program Design and Cost Estimation Study Approval 26-338 INFORMATION CONTACT: Bjorn E. Hansen, Planning Department, Senior Planner - Long Range Planning, 704-283-3690 ACTION REQUESTED: Approve recommended designs for five intersections in study . PRIOR BOARD ACTIONS: 1) October 21, 2024, Regular Meeting, Agenda Item #24-644 - Authorized staff to apply for CRTPO grant 2) June 2, 2025, Regular Meeting, Agenda Item #25-329 - Authorized interlocal agreements with participating municipalities BACKGROUND: Union County, in partnership with Indian Trail, Monroe, Unionville and Wesley Chapel, has completed the design and cost estimation work for five intersections identified in the 2023 Critical Intersection Analysis. The intersections are: ·Unionville- Indian Trail Road at Unionville Brief and East CJ Thomas (Unionville) ·Lancaster and Bragg (Monroe) ·New Town and Lester Davis (Wesley Chapel) ·Old Charlotte and Hayes /Faircroft (Indian Trail) ·NC 84 and Willoughby The County, municipalities, NCDOT, and CRTPO met from October 2025 through May 2026 to analyze conditions, evaluate options, develop designs, engage the public, and identify a recommended design and cost . The public was consulted in March with virtual community meetings and Page 14 of 16 15 Board of Commissioners Meeting Agenda June 16, 2026 online survey. The four municipalities have approved the designs within their boundaries. The intersection of NC 84 and Willoughby is the only intersection in unincorporated Union County . Approval does not commit Union County to funding the recommended improvements. The designs and cost estimates may be used by the County, municipalities, and NCDOT in future grant applications for implementation. FINANCIAL IMPACT: None. Proclamation - America 250 Month26-337 INFORMATION CONTACT: Liz Cooper, Public Communications, Director, 704-283-3587 ACTION REQUESTED: Adopt Proclamation recognizing July 2026 as America 250 Month in Union County. PRIOR BOARD ACTIONS: None. BACKGROUND: On July 4, 2026, our nation will celebrate the 250th anniversary of this historic event, known nationwide as “America 250.” This proclamation recognizes the 250th anniversary of the signing of the Declaration of Independence on July 4, 1776, and encourages residents to reflect on the nation's founding principles of liberty, equality, and democracy . It also highlights Union County's contributions to the history of North Carolina and the United States, while encouraging participation in local commemorative events and activities that honor our shared history, promote civic engagement, and foster community pride and unity . FINANCIAL IMPACT: None. Appointments to Boards and Committees26-341 INFORMATION CONTACT: Lynn G. West, Clerk to the Board, 704-283-3853 ACTION REQUESTED: Appoint members PRIOR BOARD ACTIONS: None BACKGROUND: Click or tap here to enter text . FINANCIAL IMPACT: None Page 15 of 16 16 Board of Commissioners Meeting Agenda June 16, 2026 County Manager's Comments Commissioners' Comments Adjournment Page 16 of 16 17 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-320 Agenda Date:6/16/2026 TITLE:..title Public Hearing - Rezoning Petition 2026-CZ-007 Beulah Church INFORMATION CONTACT: Bjorn E. Hansen, Planning Department, Senior Planner - Long Range Planning, 704-283-3690 ACTION REQUESTED: Conduct public hearing for rezoning petition PRIOR BOARD ACTIONS: None BACKGROUND: This case is a request to rezone a 3.21 acre parcel appearing on the tax map as tax parcel 06-042- 001J located on Beulah Church Road from B-2 with Conditions to B-2 with Modified Conditions. The rezoning request is an amendment to an existing conditional rezoning on the site and includes the following amended conditions: 1)Hours of operation changed from 9:00 AM to 9:00 PM to 6:30 AM to 9:30 PM 2)Any required privacy fence will be made of solid material to reduce noise 3)Trash and recycling pickup will occur between 9:00 AM and 5:00 PM The second and third conditions were added by the Land Use Board at its May 19, 2026 meeting as a response to resident concerns over noise. These additional conditions were agreed to by the applicant. The Land Use Board then recommended approval on a 7-0 vote, citing consistency with the land use map used in the initial rezoning and increased flexibility for the owner. If the Board of Commissioners wishes to make a decision on this rezoning petition, it can consider the following motions. To approve the proposed amendment (the proposal is consistent with the current plan) Motion (i) Adopt the Ordinance Approving Revision to the Official Zoning Map of Union County, North Carolina, and (ii) adopt the consistency and reasonableness statement for approval. To deny the proposed amendment (the proposal is inconsistent with the current plan) Motion (i) Deny rezoning petition CZ-2026-007 submitted by R. Dean Harrell; and (ii) adopt the consistency Union County, NC Printed on 6/1/2026Page 1 of 2 powered by Legistar™18 File #:26-320 Agenda Date:6/16/2026 and reasonableness statement for denial. FINANCIAL IMPACT: None Union County, NC Printed on 6/1/2026Page 2 of 2 powered by Legistar™19 1 Planning Department 500 North Main Street, Suite 70 Monroe, NC 28112 T 704.283.3565 unioncountync.gov Rezoning Request CZ-2026-007 Beulah Church This case is a request to rezone a 3.21 acre parcel appearing on the tax map as tax parcel 06- 042-001J located on Beulah Church Road from B-2 with Conditions to B-2 with Modified Conditions. The rezoning request is an amendment to an existing conditional rezoning on the site and includes the following amended conditions: 1) Hours of operation changed from 9:00 AM to 9:00 PM to 6:30 AM to 9:30 PM 2) Any required privacy fence will be made of solid material to reduce noise 3) Trash and recycling pickup will occur between 9:00 AM and 5:00 PM Contact Information 1. Staff: Bjorn Hansen, Senior Planner, 704-283-3690, bjorn.hansen@unioncountync.gov 20 2 2. Owner: Beulah Church Road Developers, LLC, 5615 Potter Road, Matthews, NC 28104 3. Applicant: Beulah Church Road Developers, LLC, 5615 Potter Road, Matthews, NC 28104 Property Information Located on the southwest corner of Beulah Church and Waxhaw Indian Trail roads. Location more specifically described as tax parcel 06-042-001J. Municipal Proximity The site is near Wesley Chapel and Weddington. North of Site Site East of Site West of Site 21 3 Existing Land Use and Development Status The parcel is currently zoned B-2 with Conditions and is undeveloped and partially forested. Environmental Features There are no streams, wetlands, or floodplains on the site. 22 4 Utilities Water and sewer are available to the site. Zoning and Land Use History This property was rezoned to B-2 with Conditions in early 2020 to allow a shopping center to be built. It was previously proposed for rezoning to B-2 in 2007, but was withdrawn. A 161 acre parcel to the north of the site was proposed for R-20 zoning in 1998, but was withdrawn. There later were two successful rezonings in 2018 and 2019 to rezone eight acres for a senior living facility on the north side of Beulah Church. There have been no other zoning actions in the immediate vicinity in unincorporated Union County. 23 5 Schools Because this rezoning request is commercial in nature, UCPS was not consulted for comments. Transportation This site is on Beulah Church and Waxhaw Indian Trail Roads, which are a NCDOT-maintained facility. This section of Waxhaw Indian Trail Road carries approximately 11,500 vehicles per day. There are no funded road improvement projects in the immediate vicinity of the rezoning. A traffic Impact Analysis (TIA) was not required for this amended rezoning. The site already has conditions for a median, crosswalk, and turn lanes into the site. 24 6 Union County Comprehensive Plan The initial 2020 rezoning for this property was evaluated against the comprehensive plan and land use map in place at the time. The land use map was amended as part of the rezoning to include a commercial node at the intersection, which was consistent with development patterns in the area. This proposed rezoning is consistent with the land use map used as part of the 2020 rezoning. The Union County 2050 land use map identifies the entire area as a Transition Zone, which recognizes the limited amount of unincorporated land and close proximity to several municipalities as reasons to restrict rezonings in this area and instead incentivize them to annex into an adjacent municipality. 25 7 2050 Plan Land Use Map 2014 Plan Land Use Map 26 8 Public and Municipal Comments Public Comments A community meeting was required and was held on April 15, 2026. A total of 17 residents attended the meeting and expressed concern over the proposed hours of operation as well as the overall development. No changes were made to the site plan as a result of the meeting. Two residents spoke against the rezoning at the May 19, 2026 Land Use Board meeting, citing concerns over safety and noise. Municipal Comments Weddington and Wesley Chapel were consulted due to the distance to their municipal limits. No responses were received. Recommendations Land Use Board The Land Use Board unanimously recommended approval at its May 19, 2026 meeting after adding two conditions, limiting trash pick up to between 9 AM to 5 PM and requiring the privacy fence to be built of solid materials to reduce noise. The Board cited consistency with the land use map used in the initial rezoning and increased flexibility for the owner. Planning Department This part of Union County at the time of the initial 2020 rezoning was identified is identified for single family residential at approximately two units per acre, with a Neighborhood Center commercial node at the intersection of this rezoning. The Land Use Map was subsequently modified through the 2050 Comprehensive Plan to recognize the limited amount of unincorporated land in the area and designated the area as a Transition Zone, meaning upzonings would not be supported. The proposed rezoning is not an upzoning of existing zoning on the site, is consistent with the land use map in place at the time of the initial rezoning and provides additional flexibility to the property owner as they develop the site. The proposed use is therefore considered appropriate for the area. Because of these aspects of the development, staff recommend approval of this rezoning application. 27 9 28 29 Application for Conditional Rezoning Union County Planning Department 500 N Main Street -Suite 70 Monroe, NC 28112 T 704.283.3565 E UCPlanning@unioncountync.gov General Information Proj ect Addr e ss l.f<7'11 WA--,<iffiu) City /11�@.<JS State bl�, Zi� � IO L/ I��\\) T�L.. P.d Tax Pa rcel \00l:,6i-(J,C:OjJCurrent Zonin9.. De signation CZ � . .,l,_;Total Acres 3, 'J.. I i'"l.. ��--- Proposed Zoning Designation sAmdcz Date Submitted (Y\!W-cb � )d,b'i-I Contact lnfor�ationApplicant Name J) t:u.-LAtt Cl-\U..1<0-\ f!.J , »� v e.. kiP<U'S LL 'IR, (1_ e,"" i-1-14 {ire.// Address SlzJ.-S i6!k_v:::: Q.�, Phone70L!�4�L/-8)(S Citl}14-.\:theLvs. State 't\lc. ZipA't3/0L( Fax. ________ Email Property Owner Name Bei...L.lA-b cl, RJ 11.v·eJop� Address;iJIS Pd--f-e.< Rel City W1±.\+-ti?LC$ State � L Zip�� /Oj Phone ]DY -56 L/ -LfB LS Fax ________ Email Signature �t'.lu:,k JopbDate g� (d'41<.LQ.EUPrinted Nam e /Title Yl,\-e..� W <2..-v--ti]/\ A vu 14. ff-e_ V ownA_r'S Cer�ation Unclude names and signatures of Rl�_owners)�. U UQ---y-::,, _fz±a.--JlJL fn� �l;.to K 1�v �d)sn·gr.ia r .e l�i� Dat� ."I �ed. Name /Ti�le A,.11 -_ �' • 8:) I Jo IJ'-. M V\t'ec11 L , SJ.kw 1.¥t;:.L� -.. c r T - Union County Office Use Only: Case Numbe r: Zp'Zi.?-GZ--001 Bev\a\...w\-Date R ec eived:_,..,_�--Zo�---21,_. --------- Amount of Fee :� DID Fee Ok: &'ai\ R e c eived by:_�-�-' _________ _ Contact Bjorn Hansen to begin the process. T. 704.283.2690 E. Bjorn.hansen@unioncountync.gov **This document is only valid from July l, 2024 -June 30, 2025 30 31 Statements of Consistency and Reasonableness for Proposed Amendment to the Union County Zoning Map The Union County Land Use Board recommended that the Union County Board of Commissioners approve the rezoning petition (CZ-2026-007), submitted by R. Dean Harrell, requesting a revision of the Union County Zoning Map by rezoning an approximately 3.207 acre parcel of land appearing on the tax map as tax parcel 06-042-001J along the south side of Beulah Church Road from B-2 with Conditions to B-2 with Modified Conditions. CONSISTENCY AND REASONABLENESS STATEMENT FOR APPROVAL OF THE PROPOSED AMENDMENT (THE PROPOSAL IS INCONSISTENT WITH THE CURRENT PLAN) (CZ-2026-007) Pursuant to N.C.G.S. § 160D-605, the Union County Board of Commissioners (the “Board”) does hereby find and determine that adoption of the proposed map amendment is consistent with the currently adopted Union County Comprehensive Plan (the “Plan”). The adoption of the proposed map amendment (i) takes into account the need to amend the zoning map to meet the needs of the community, and (ii) is reasonable and in the public interest because: 1. The proposed use under the amendment is consistent with the 2014 Land Use Plan, which was in place at the time of initial rezoning of the property in 2020 to B-2 with Conditions. The 2014 Plan’s Land Use Map identified this area as a Commercial Center. The Commercial Center designation would support a range of retail and service uses, consistent with the existing allowed uses. The current Plan’s Land Use Map now designates this area as a Transition Zone. The Transition Zone designation encourages, but does not require, developers to consider annexation into an adjacent municipality. The Plan also provides a strategy of Union County not approving rezonings in a Transition Zone which would “upzone” the property and increase density or intensity of uses. The modified condition of several additional hours of operating hours does not increase density or the overall allowed uses under the property. Rather, it is an operational condition change which does not reach such an impact and is consistent with the Plan. 2. The proposed change in the condition of hours of operation would still prohibit late night operations (prohibiting hours of operation between 9:30 p.m. to 6:30 a.m.) that could impact adjacent residential areas. 3. The tract of land is not overly small for the general area in which it is located and is reasonable in size for the modified conditions contemplated. 4. The property itself is already zoned for B-2 uses with conditions. Additionally, the property is located less than 0.2 miles from an existing retail business use with currently almost the same operating hours as proposed under the modified conditions. 5. The use set forth under the conditions would meet Union County development standards. 6. The benefits to the community at large, the neighbors, and the property owners of the proposed rezoning outweigh any detriments to the neighbors and others caused by the rezoning. The benefits of this rezoning include allowing retail and service business opportunities in Union County. The potential detriments of the use established by this 32 rezoning include any increased noise, light, and traffic exposure resulting from the proposed use that could affect nearby properties. 33 CONSISTENCY AND REASONABLENESS STATEMENT FOR DENIAL OF THE PROPOSED AMENDMENT (THE PROPOSAL IS INCONSISTENT WITH THE CURRENT PLAN) (CZ-2026-007) Pursuant to N.C.G.S. § 160D-605, the Union County Board of Commissioners (the “Board”) does hereby find and determine that this rezoning petition is inconsistent with the Union County Comprehensive Plan (the “Plan”), and that denial of the proposed map amendment is reasonable and in the public interest because: 1. The proposed rezoning could facilitate additional ongoing and potential commercial rezonings in the immediate area inconsistent with the current Land Use Map in Transition Zones, including in close proximity to existing residential uses. 2. Allowed hours of operation on the property could result in increased congestion on the roads and streets adjacent and nearby to the property. Traffic congestion is a noted concern in the Plan. 34 BOCC Motions for Proposed Amendment to the Union County Zoning Map (CZ-2026-007) The Union County Land Use Board recommended that the Union County Board of Commissioners approve the rezoning petition (CZ-2026-007), submitted by R. Dean Harrell, requesting a revision of the Union County Zoning Map by rezoning an approximately 3.207 acre parcel of land appearing on the tax map as tax parcel 06-042-001J along the south side of Beulah Church Road from B-2 with Conditions to B-2 with Modified Conditions. TO APPROVE THE PROPOSED AMENDMENT (THE PROPOSAL IS CONSISTENT WITH THE CURRENT PLAN) Motion (i) Adopt the Ordinance Approving Revision to the Official Zoning Map of Union County, North Carolina, and (ii) adopt the consistency and reasonableness statement for approval. TO DENY THE PROPOSED AMENDMENT (THE PROPOSAL IS INCONSISTENT WITH THE CURRENT PLAN) Motion (i) Deny rezoning petition CZ-2026-007 submitted by R. Dean Harrell; and (ii) adopt the consistency and reasonableness statement for denial. 35 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-321 Agenda Date:6/16/2026 TITLE:..title Public Hearing - Rezoning Petition 2026-CZ-005 McAteer INFORMATION CONTACT: Bjorn E. Hansen, Planning Department, Senior Planner - Long Range Planning, 704-283-3690 ACTION REQUESTED: Conduct public hearing for proposed rezoning PRIOR BOARD ACTIONS: None BACKGROUND: This case is a request to rezone a 5.75 acre portion of a 17.21 acre parcel appearing on the tax map as tax parcel 09-384-013 located on South Rocky River Road from RA-40 to Light Industrial (LI) with Conditions. The rezoning request is a conditional rezoning, and includes the following conditions: 1)Limited to approved site plan dated April 6, 2026 2)Uses limited to office, warehouse and construction equipment and material storage 3)5.75 acre portion will be subdivided from parcel 4)Five-year vesting of development rights 5)Development will meet all requirements of the Union County Unified Development Ordinance on the date of approval The Land Use Board unanimously recommended approval at its May 19, 2026 meeting, citing consistency with the Land Use Map and increased business opportunities. If the Board of Commissioners wishes to make a decision on this rezoning petition, it can consider the following motions: To approve the proposed amendment (the proposal is consistent with the current plan) Motion (i) Adopt the Ordinance Approving Revision to the Official Zoning Map of Union County, North Carolina, and (ii) adopt the consistency and reasonableness statement for approval. To deny the proposed amendment (the proposal is inconsistent with the current plan) Motion (i) Deny rezoning petition CZ-2026-005 from Jeremy McAteer; and (ii) adopt the consistency and Union County, NC Printed on 6/1/2026Page 1 of 2 powered by Legistar™36 File #:26-321 Agenda Date:6/16/2026 reasonableness statement for denial. FINANCIAL IMPACT: None Union County, NC Printed on 6/1/2026Page 2 of 2 powered by Legistar™37 1 Planning Department 500 North Main Street, Suite 70 Monroe, NC 28112 T 704.283.3565 unioncountync.gov Rezoning Request CZ-2026-005 McAteer This case is a request to rezone a 5.75 acre portion of a 17.21 acre parcel appearing on the tax map as tax parcel 09-384-013 located on South Rocky River Road from RA-40 to Light Industrial (LI) with Conditions. The rezoning request is a conditional rezoning, and includes the following conditions: 1) Limited to approved site plan dated April 6, 2026 2) Uses limited to office, warehouse and construction equipment and material storage 3) 5.75 acre portion will be subdivided from parcel 4) Five-year vesting of development rights 5) Development will meet all requirements of the Union County Unified Development Ordinance on the date of approval 38 2 Contact Information 1. Staff: Bjorn Hansen, Senior Planner, 704-283-3690, bjorn.hansen@unioncountync.gov 2. Owner: McAteer Family Living Trust, 1115 McAteer Road, Monroe, NC 28112 3. Applicant: Jeremy McAteer, 1115 McAteer Road, Monroe, NC 28112 Property Information Located on the east side of South Rocky River Road south of NC 75. Location more specifically described as tax parcel 09-384-013. Municipal Proximity The site is one mile east of Mineral Springs. North of Site Site East of Site West of Site 39 3 Existing Land Use and Development Status The parcel is currently zoned RA-40 and is used for row crops. Environmental Features There is a stream in the center of the parcel, but it does not impact the portion being rezoned. The entire parcel is within the Lake Lee Water Supply Watershed, which limits impervious surface. The proposed site plan meets the watershed development standards. 40 4 Utilities Water is available to the site and will rely on septic for sewer service. Zoning and Land Use History This property has been zoned RA-40 since zoning was instituted in Union County. There have been several rezonings to Light Industrial immediately north of this property since 1977. Two large residential rezonings south of the site were proposed in 2019 and 2022 and were denied. Two special use permits for day care facilities west of the site were approved in 1981 and 1996. There have been no other zoning actions in the immediate vicinity in unincorporated Union County. 41 5 Schools Because this rezoning request is commercial in nature, UCPS was not consulted for comments. Transportation This site is on South Rocky River Road, which is a NCDOT-maintained facility. This section of South Rocky River Road carries approximately 4,900 vehicles per day. There are no funded road improvement projects in the immediate vicinity of the rezoning. A traffic Impact Analysis (TIA) was not required for this rezoning. The anticipated trip generation for this site is expected to be low, although it will have a high percentage of truck traffic. 42 6 Union County Comprehensive Plan The Union County 2050 comprehensive plan identifies this area as a Rural Residential area with an Employment Corridor overlay. The uses proposed under Light Industrial zoning are consistent with the intent of the Employment Corridor. 43 7 Public and Municipal Comments Public Comments A community meeting was required and was held on April 28, 2026. A total of two residents attended the meeting and asked questions about parcels impacted by the rezoning, approval process, and implementation timeline. No changes were made to the site plan as a result of the meeting. Municipal Comments Mineral Springs was not consulted due to the distance to their municipal limits. Recommendations 44 8 Land Use Board The Land Use Board reviewed this rezoning request at its May 19, 2026 meeting and unanimously recommended approval based on consistency with the land use map and business opportunities for owner. Planning Department This part of Union County is identified as an Employment Corridor overlaid on rural residential and agricultural land uses. The proposed use is allowed in Light Industrial, which is an appropriate zoning designation in an Employment Corridor. The proposed traffic impacts are moderate and this use will increase business opportunities in Union County. The proposed use is therefore considered appropriate for the area. Because of these aspects of the development, staff recommend approval of this rezoning application. 45 PPPPPPPPPPPPPPPPPPARCEL ID: 09384017 BILLY K. McATEER AND HELEN C. McATEER DB. 973 PG. 607 PARCEL ID: 09384013A SHONE M. HOUSTON DB. 1819 PG. 517 P P P P P P P C/L OF DITCH (PER UNION COUNTY GIS)N4 7 ° 3 8 ' 4 3 "W 5 3 2 . 8 9 ' N56 ° 3 3' 0 9" E 513. 2 2' ( T O T A L) S75° 5 1 ' 2 7 " E 296. 8 1 ' ( S E E NO T E 1 2 ) P P P P P P P P C/L OF DITCH (PER UNION COUNTY GIS) C/L OF DITCH C/L OF DITCH 294.76 S81°10' 4 3 " E 30' Power Easeme n t ( D i s t r i b u t i o n ) See Notes 15' 15' PARCEL ID: 09381005 KAFE CA HOLDINGS, LLC DB. 9262 PG. 563 PARCEL ID: 09381003 McATEER FAMILY LIVING TRUST DB. 9281 PG. 877 TRACT 1 ~ PLAT CAB L PG. 832 653 652 651 650 649 648 648 650 647646649650 653 652 651 654 653 652 651 650 650 651 652 651652653 654 649 WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W W W W W W W W W W W W W W W W W W W W W W W W W WWWWWWWWWWWOFFICE 68' X 60' (4K SF) (HEIGHT TO COMPLY WITH LI ZONING REQUIREMENTS) WAREHOUSE 50' X 125' (6K SF) ABC GRAVEL LAYDOWN AREA (+/-63K SF) 50' F R O N T S E T B A C K 50' REAR S E T B A C K 20' SIDEYARDAPPROXIMATE SEPTIC SYSTEM AREA LOCATION SUBJECT TO PERC. TEST S R O C K Y R I V E R R D 3 5 . 0 '20' SIDEYARDPROPERTY BOUNDARYPROPERTY BOUNDARYPROPERTY B O U N D A R Y 68.0'60 . 0 '125.0'5 0 . 0 '20.0'CO V E R E D F R O N T P O R C H 30.0 '30.0 '50.0'EX . R / W ( 3 0 ' D E D I C A T I O N F R O M C L O F S R O C K Y R I V E R ) EX. R / W POTENTIAL FUTURE BUILDING EXPANSION +/-50'x50' GRASS AREA SCM (+/-18K SF - FINAL SIZE TBD) EXISTING WATER LINE PROPOSED WATER LINE (8) SPACES 9'x19' (PER UDO,TYP.) HEAVY DUTY CONCRETE, TYP. LIGHT DUTY CONCRETE, NO C&G, TYP. EXISTING TREE LINE, TYP. (8) SPACES (1) VAN ACCESIBLE ADA SPACE ACCESS GATE 8' HT. CHAINLINK FENCE, TYP. EXISTING EOP EXISTING CL 5' SW, TYP. 5' PLANTING AREA ADA RAMP TREE CONSERVATION AREA LOCATED WITHIN PROPERTY SETBACK (FUTURE MITIGATION MAY BE REQUIRED BASED ON TREE SURVEY FINDINGS ) NOTE: PROPOSED PARKING LOTS MAY EXTEND UP TO 20' INTO FRONT SETBACK PER UDO EXISTING STREAM (PER UNION COUNTY GIS) 30' STREAM BUFFER 30' EXISTING POWERLINE EASEMENT CL DITCH, TYP. PROPOSED DRIVEWAY (NCDOT DRIVEWAY PERMIT TO BE ACQUIRED AT LATER DATE) NCDOT 10' X 70' SIGHT TRIANGLE S63°1 7' 2 9 " W 22600. 6 3 ( G R I D ) 22603 . 8 1 ( G R O U N D ) PARCEL ID: 09381005 RONNIE LANEY CONSTRUCTION CO, INC. DB. 1285 PG. 765 PARCEL ID: 09381024 BARBARA FAYE GRIFFIN HELMS DB. 3575 PG. 498 PARCEL ID: 09384012 ROBERT PAGE STEWART AND VICKIE T. STEWART DB. 307 PG. 590 PARCEL ID: 09384014 ALEXANDER PAGE HEIRS DB. PG. PARCEL ID: 09384011G FRANKLIN W. HOWEY, JR. DB. 885 PG. 538 PARCEL ID: 09384017BILLY K. McATEER ANDHELEN C. McATEERDB. 973 PG. 607 PARCEL ID: 09384013ASHONE M. HOUSTONDB. 1819 PG. 517 PARCEL ID: 09381003B DOUGLAS O. McATEER DB. 3136 PG. 20 PC. D PG. 978 PIER C/L OF DITCH(PER UNION COUNTY GIS) CANAL S01°02'14"E344.31'S88°57'46"W 214.93'S01°02'14"E931.63'N88°56'17"E 254.93'S00°27'11"E498.45'N 4 5 ° 5 4 ' 0 9 "W 6 7 9 . 6 4 ' N82°17'43"W 518.73' L1N81°20'54" W 477.13'L2L3S2 8 °50 '44 "E451 .87 ' S66°58' 3 8 " W 362.28' L4 L5N47° 3 8 ' 4 3 " W 53 2 . 8 9 ' N56°3 3 ' 0 9 " E 513.22' ( T O T A L ) S75°51'27" E 296.81'N05°11'46"E892.88'N61°1 5' 4 5" E 418.8 6'L6L7L8 L9L10 (NOT T O S C A L E )100' 60' DB. 237 PG. 140 (PORTION) CP CP CP (SEE N O T E 1 2 )(60' PUBLIC RIGHT OF WAY)240.02 N80°30'03" W 639.22 S16°24'20"W995.7036.41 *SEE AREA TABLEDB. 237 PG. 140 (PORTION) 200.70 CHAIN LINK FENCE N.C. HI G H W A Y 7 5 60' PUB L I C R I G H T - O F- W A Y P.C. L, P G . 8 3 2 LEGEND 369 SET 370 SET 371 SET 372 SET 373 IRON FOUND 375376377378379380381382383384385387388389390 374391 392 393394395396397 398399400401402403404405406407408409410411 412 413 414 415416 417418419420 421422423424425426427428429430431432433434N61° 1 7' 4 0" E 1 8 1. 2 4'S23°45'18"E 327 .84 ' S65°4 9' 1 9 " W 1 4 7. 8 4'N29°43 '05 "W 315 .00 ' 800664.670 NCGS U51 N65°05'33"E 2,516.16' ( H . G . ) 2,515.81' ( G R I D ) NTS N.C.G.S. "U51"PID: EC0165N:443734.35E:1512250.09N.A.D. 83/2011 N:444793.89E:1514531.90N.A.D. 83/2011 S61°18'02" W 1 9 2 4 . 6 3 ' ( T I E ) #4 REBAR (F)MCATEER ROAD60' PUB LIC RIGHT -OF-WAYP.C. L , PG . 832 D.B. 7675, PG. 478TRACT 1P.C. L, FILE 832P.N. 09381003 JEREMY D. MCATEERAND WIFE, AMBER L. MCATEERD.B. 7675, PG. 478TRACT 1P.C. L, FILE 832P.N. 09381003 FARMS, LLCD.B. 7279, PG. 602(PARCEL ONE)P.N. 0938400140' R IG H T-O F -W AY P.C . D , P G . 978 60' 54984 SQ.FT. 1.26 AC. TRACT 352,773 SQ.FT.OR 1.21 AC.(NEW TRACT) 40' S.B. 15' S . Y . 15' S . Y . 40' R.Y.PAVED ROAD NTS 801 LOOK LOOK 803 LOOK 805 LOOK806 LOOK 807 LOOK 20001 EX ANGLE IRON NAB SET AT BASE FND 20003 WDF1 B 20004 WDF1 E AT BLDG 20005 WDF1 B 20006 WDF1 20007 WDF1 20008 WDF1 20009 WDF1 20010 WDF1 20011 WDF1 20012 WDF1 20013 WDF1 20014 WDF1 20015 WDF1 20016 WDF1 20017 WDF1 20018 WDF1 20019 WDF1 20020 WDF1 20021 WDF1 20022 WDF1 20023 WDF1 20024 WDF1 20025 WDF1 20026 WDF1 20027 WDF1 20028 WDF1 20029 WDF1 20030 WDF1 20031 WDF1 20032 WDF1 20033 WDF1 20034 WDF1 20035 WDF1 20036 WDF1 20037 WDF1 20038 WDF1 20039 WDF1 20040 WDF1 E 20041 EC1 B PILLAR 20042 EC1 PILLAR 20043 EC1 PILLAR 20044 EC1 CLO PILLAR 20045 EC1 B PILLAR 20046 EC1 PILLAR 20047 EC1 PILLAR 20048 EC1 CLO PILLAR 20049 WDF1 B 20050 WDF1 20051 WDF1 20052 WDF1 20053 WDF1 20054 WDF1 20055 WDF1 E AT OLD FNCE 20056 WDF1 B 20057 WDF1 20058 WDF1 20059 WDF1 20060 WDF1 20061 WDF1 20062 WDF1 20063 WDF1 20064 WDF1 20065 WDF1 20066 WDF1 20067 WDF1 20068 WDF1 20069 WDF1 20070 WDF1 20071 WDF1 20072 WDF1 20073 WDF1 20074 WDF1 20075 WDF1 20076 WDF1 20077 WDF1 20078 WDF1 E 20079 WDF1 B 20080 WDF1 20081 WDF1 20082 WDF1 20083 WDF1 20084 WDF1 20085 WDF1 20086 WDF1 20087 WDF1 E 20088 WDF1 B J 20086 20089 WDF1 20090 WDF1 E AT BLDG20091 WDF1 B 20092 WDF1 E AT BLDG20093 WDF1 B 20094 WDF1 20095 WDF1 20096 WDF1 20097 WDF1 20098 WDF1 20099 WDF1 20100 WDF1 20101 WDF1 20102 WDF1 20103 WDF1 20104 WDF1 20105 WDF1 20106 WDF1 E JEREMY D. MCATEERAND WIFE, AMBER L. MCATEER 52773 SQ.FT. 40' C/L OF DITCH(PER UNION COUNTY GIS) C/L OF DITCH C/L OFDITCH 294.76 S81°10'43"E 30' Power Easement (Distribution) See Notes 15' 15' PARCEL ID: 09381005KAFE CA HOLDINGS, LLCDB. 9262 PG. 563 PARCEL ID: 09381003McATEER FAMILY LIVING TRUSTDB. 9281 PG. 877TRACT 1 ~ PLAT CAB L PG. 832 653 652 651650649 648 648 650 647 646 649650 653652 651 654653 652 651 650 650 651 652 651652 653 654649 68.0'60.0' 125.0' 50.0' 20.0' 30.0' 30.0' 50.0' GENERAL NOTES 1.ALL SITE PLAN, ZONING, AND EXISTING CONDITION INFORMATION UTILIZED IN THE PREPARATION OF THIS PLAN IS CONSIDERED TO BE PRELIMINARY IN NATURE AND SUBJECT TO CHANGE AND FINAL VERIFICATION. 2.THIS DOCUMENT IS CONCEPTUAL IN NATURE. DO NOT RELY ON THIS FOR PERMITTING, CONSTRUCTION, BIDDING, ETC. 3.BASE MAP INFORMATION IS DESKTOP GIS DATA AND HAS NOT BEEN FIELD VERIFIED. 4.THE EXISTING TREE LINE AREAS HAVE SIGNIFICANT TOPOGRAPHIC DECLINE AND THE AREAS NEED TO BE FIELD ASSESSED TO DETERMINE IF STREAMS OR WETLANDS ARE PRESENT. DUE TO THIS UNKNOWN, BUFFERS ARE NOT ACCOUNTED AS PART OF THIS CONCEPT PLAN OPEN SPACE/TREE SAVE THE OPEN SPACE AND TREE SAVE AREAS SHOWN ON THIS PLAN ARE CONCEPTUAL AND PRELIMINARY. THEIR EXACT LOCATIONS ARE SUBJECT TO CHANGE AS THE CLIENT FINALIZES THE OVERALL SITE LAYOUT, PRODUCT ALLOCATION, AND OTHER SPATIALLY DEPENDENT PROJECT COMPONENTS. STREAM/WETLAND INFORMATION THE STREAM AND WETLAND DATA SHOWN ON THIS PRELIMINARY CONCEPT PLAN ARE BASED ON IREDELL COUNTY GIS INFORMATION AND HAVE NOT BEEN FIELD-VERIFIED FOR ACCURACY. ALL POTENTIAL WETLAND AREAS AND STREAM FEATURES DEPICTED ARE APPROXIMATE IN LOCATION AND PRELIMINARY IN NATURE. THIS CONCEPT PLAN IS SUBJECT TO REVISION UPON COMPLETION OF DETAILED FIELD SURVEYS AND VERIFICATION OF JURISDICTIONAL BOUNDARIES BY THE APPROPRIATE REGULATORY AGENCIES. FINAL DELINEATION MAY RESULT IN CHANGES TO THE SITE LAYOUT, AND POTENTIAL UNIT LOSS MAY OCCUR AS A RESULT OF THESE ADJUSTMENTS. FLOODPLAIN INFORMATION FLOOD PLAIN INFORMATION OBTAINED FROM FEMA FIRM PANEL 3710466600J EFFECTIVE DATE OF 03/18/2008. NO FLOODPLAIN LOCATED ON THE PROPERTY STORMWATER CONTROL MEASURES THE LOCATION AND SIZE OF PROPOSED STORMWATER CONTROL MEASURES ARE CONCEPTUAL AND PRELIMINARY. FINAL STORMWATER DESIGN WILL BE DETERMINED AS THE OVERALL PROJECT LAYOUT, PRODUCT ALLOCATION, AND OTHER KEY PROJECT ELEMENTS ARE REFINED. THESE AREAS ARE SUBJECT TO CHANGE BASED ON FINAL ENGINEERING, AND AS SUCH, THE SITE LAYOUT AND TOTAL UNIT COUNT MAY ALSO BE ADJUSTED TO ACCOMMODATE STORMWATER REQUIREMENTS. ACCESS POINTS/DRIVEWAYS/STREETS 1.PROPOSED SITE ENTRANCE LOCATIONS ARE PRELIMINARY AND MUST BE EVALUATED TO CONFIRM ADEQUATE SIGHT DISTANCE. 2.ALL INTERNAL ROADWAY AND STREET SYSTEMS SHOWN ARE CONCEPTUAL AND SUBJECT TO CHANGE. FINAL DESIGN MUST BE REVIEWED AND VERIFIED FOR COMPLIANCE WITH THE TOWN OF MOORESVILLE UNIFIED DEVELOPMENT ORDINANCE (UDO) AND APPLICABLE NCDOT STANDARDS. 3.PROPOSED STREET CONNECTIONS ARE ALIGNED WITH EXISTING ROADS BUT ARE CONCEPTUAL AND MAY BE ADJUSTED BASED ON FEEDBACK AND REQUIREMENTS FROM REVIEWING AGENCIES. DISCLAIMER ON SOURCE DATA ACCURACY: P3 CIVIL EXPRESSLY DISCLAIMS ANY LIABILITY FOR PLAN DEFICIENCIES OR ERRORS ARISING FROM RELIANCE ON INCORRECT, INCOMPLETE, MISSING, OR OUTDATED INFORMATION OBTAINED FROM PUBLIC SOURCES, INCLUDING BUT NOT LIMITED TO GIS DATA, PLANNING, OR ZONING DEPARTMENTS. THE CLIENT ACKNOWLEDGES AND AGREES THAT VERIFICATION OF ALL SUCH DATA IS THEIR SOLE RESPONSIBILITY, AND P3 CIVIL SHALL NOT BE HELD RESPONSIBLE FOR ANY DAMAGES, LOSSES, OR COSTS RESULTING FROM INACCURACIES IN THIRD-PARTY SOURCE INFORMATION. P3 CIVIL. PLLC 750 Imperial Ct Charlotte, NC 28273 www.p3-civil.com CONCEPT PLAN MCATEER DESIGN OFFICE VICINITY MAP NTS DEVELOPMENT SUMMARY NOTES P3 JOB # 2025-0018 DECEMBER 15, 2025 GRAPHIC SCALE TAX PARCELS: 09384013 - UNION COUNTY TOTAL PID ACREAGE:+/-17.21 AC. (PER GIS) TO BE SUBDIVIDED & DEVELOPED:+/-5.75 AC. REMAINING AC. TO BE EXCLUDED:+/-11.46 AC. LOCATION: UNION COUNTY ZONING: EXISTING: RA-40 (RESIDENTIAL - AGRICULTURAL) PROPOSED: LI (LIGHT INDUSTRIAL) REZONING REQUIRED PROPOSED USE: OFFICE, GARAGE, LAYDOWN YARD MIN. LOT SIZE LI: NO MIN. PROPOSED LOT SIZE: +/-5.75 AC. MAX. IMPERVIOUS AREA (WHEN NO C&G PROPOSED): 36% PROPOSED IMPERVIOUS AREA: 36% FRONT SETBACK: 50' REAR SETBACK: 50' SIDEYARD: 20' MAX. BLDG HEIGHT: 100' PARKING REQUIRED: 0.5 SPACES PER EMPLOYEE 15 EMPLOYEES ANTICIPATED = 7.5 SPACES REQUIRED 0 LOADING SPACES REQUIRED (0-15k SF GROSS FLOOR AREA) PARKING PROPOSED: 16 SPACES - 9' X 18' 1 VAN ACCESSIBLE ADA SPACE TREE SAVE: TREE INVENTORY SURVEY REQUIRED IN AREAS "OUTSIDE THE BUILDABLE AREA OF A LOT OR DEVELOPMENT SITE". BUILDABLE AREA = ALL AREAS LOCATED OUTSIDE SETBACKS, R/W'S, EASEMENTS. I.E. - TREE SURVEY REQUIRED WITHIN PROPERTY SETBACK AREAS TREES DBH OF 12" OR GREATER MUST BE MITIGATED AT 125% OD DBH REMOVED OPEN SPACE: NOT REQUIRED FOR LI WATERSHED: UPPER RICHARDSON CREEK (PROJECT IS LOCATED IN A WATER SUPPLY WATERSHED) TOTAL SF ALL STRUCTURES:+/- 10K SF TOTAL ACREAGE TO BE DISTURBED:XX TOTAL ACREAGE IN R/W:XX WATER SOURCE:S ROCKY RIVER RD PUBLIC WATER LINE (TAP TO BE PROPOSED) WASTEWATER SOURCE PROVIDER: SEPTIC SYSTEM TO BE PROVIDED (SEE OWNER, DEVELOPER, CONSULTANT INFO) TOTAL ACREAGE IN R/W:+/- 0.019 AC. (DRIVEWAY CONNECTION TO S ROCKY RIVER RD) TOTAL DISTURBED AREA:+/- 2.72 AC. (+/- 47% OF TOTAL SITE) LEGEND: COS COMMON OPEN SPACE SCM STORMWATER CONTROL MEASURE SITE MCATEER RDS R O C K Y R I V E R R D POTENTIAL R/W DEDICATION STREAM LINE (PER GIS) FLOOD PLAIN (FROM GIS) POSSIBLE STREAM (PER GIS TOPO) NATURAL GAS EASEMENT PERIMETER BUFFER WAXH A W H W Y UNION COUNTY NOTES THOUGH IT MAY NOT BE ILLUSTRATED, SHOWN, LISTED, DENOTED, OR EXPRESSED THIS PLAN SHALL COMPLY WITH ALL PROVISIONS OF THE UNION COUNTY LAND DEVELOPMENT ORDINANCE IN EFFECT AT TIME OF REVIEW AND APPROVAL PARKING LOT SURFACE SHALL BE MAINTAINED IN SUCH A MANNER TO PREVENT, REPAIR, OR REPLACE DETERIORATED SURFACE MATERIAL, POTHOLES AND MAJOR CRACKING OF IMPERVIOUS/PERVIOUS SURFACE MATERIAL AND STRIPING SHALL BE VISIBLE AND WELL DEFINED. FOR PRESERVED VEGETATION, MAINTENANCE SHALL BEGIN AT THE TIME THAT THE ROOT PROTECTION ZONES ARE ESTABLISHED (PRIOR TO ROUGH GRADING) AND SHALL CONTINUE INDEFINITELY. FOR PLANTED MATERIALS, MAINTENANCE SHALL BEGIN AT THE TIME OF PLANTING AND SHALL CONTINUE INDEFINITELY. NO OUTDOOR LIGHTING PROPOSED. OWNER, DEVELOPER, CONSULTANT INFORMATION OWNER: JEREMY DAVID MCATEER 1115 MCATEER ROAD MONROE, NC 28112 DEVELOPER: JEREMY DAVID MCATEER 1115 MCATEER ROAD MONROE, NC 28112 WASTEWATER CONSULTANT THOMPSON ENVIRONMENTAL CONSULTING PO BOX 541 MIDLAND, NC 28107 704-307-4881 TREE CONSERVATION AREA TOTAL ACREAGE IN R/W:+/- 0.019 AC. (DRIVEWAY CONNECTION TO S ROCKY RIVER RD) TOTAL DISTURBED AREA:+/- 2.72 AC. (+/- 47% OF TOTAL SITE) APRIL 6, 2026 46 PPPPPPPPPPPPPPPPPP P P P P P P C/L OF DITCH (PER UNION COUNTY GIS) P P P P P P P P 199 pp 200 rbf 201 guy 202 pp 207 pp 208 pp 659 pp 660 pp 665 pp 666 guy 667 rbf 668 pp 2159 pp 2160 pp 2165 pp 2166 guy 2167 rbf 2168 pp 808 BNDRY 809 BNDRY 452648.790 INV CALC 15800 648.790 INV CALC 18" INV:649.32 INV:648.79 INV:649.57 C/L OF DITCH (PER UNION COUNTY GIS) C/L OF DITCH C/L OF DITCH 30' Power Easem e n t ( D i s t r i b u t i o n ) See Notes 15' 15' 18" RCP 15" RCP 653 652 651 650 649 648 648 650 647646649650 653 652 651 654 653 652 651 650 650 651 652 651652653 654 649 WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W W W W W W W W W W W W W W W W W W WW W W W W W WWWWWWWWWWWOFFICE WAREHOUSE ABC GRAVEL LAYDOWN AREA (+/-65K SF) 50' F R O N T S E T B A C K 50' REAR SETBA C K 20' SIDEYARDAPPROXIMATE SEPTIC SYSTEM AREA LOCATION SUBJECT TO PERC. TEST S R O C K Y R I V E R R D EXISTING WATER LINE PROPOSED WATER LINE (8) SPACES 9'x19' (PER UDO,TYP.) EXISTING TREE LINE, TYP. 3 5 . 0 '654652650648652650648646ACCESS GATE 8' HT. CHAINLINK FENCE, TYP.20' SIDEYARDPROPERTY BOUNDARYPROPERTY BOUNDARYPROPERTY BOUN D A R Y EXISTING CL 5' SW, TYP. 5' PLANTING AREA CO V E R E D F R O N T P O R C H EXISTING STREAM (PER UNION COUNTY GIS) 30' STREAM BUFFER30.0 '30.0 ' SCM (+/-18K SF - FINAL SIZE TBD) (18) IG (10) IV (14) IG (10) IV (13) IV (12) IV (10) IV (12) IG (1) AR (9) QP (1) AR NCDOT 10' X 70' SIGHT TRIANGLE P3 CIVIL. PLLC 750 Imperial Ct Charlotte, NC 28273 www.p3-civil.com CONCEPT PLAN MCATEER DESIGN OFFICE VICINITY MAP NTS DEVELOPMENT SUMMARY NOTES P3 JOB # 2025-0018 DECEMBER 15, 2025 GRAPHIC SCALE PLANT SCHEDULE PLANTING REQUIREMENTS - PER UNION COUNTY UDO SEC. 55.040 - STREET FRONTAGE LANDSCAPING STREET FRONTAGE LANDSCAPING MUST BE PROVIDED ADJACENT TO PUBLIC STREET RIGHTS-OF-WAY. LANDSCAPING AND SCREENING IS REQUIRED IN ACCORDANCE WITH THE S1 SCREENING STANDARDS OF §55.090-B. S1 SCREENING REQUIRED REQUIRES A HEDGEROW, DENSE PLANTING OF SHRUBS OR ORNAMENTAL GRASSES, DECORATIVE MASONRY WALL OR ANY COMBINATION OF SUCH FEATURES THAT RESULTS IN A CONTINUOUS VISUAL BARRIER AT LEAST 3 FEET IN HEIGHT. IN ADDITION, AT LEAST ONE TREE IS REQUIRED PER 50 LINEAR FEET OF SCREEN. TOTAL R/W FRONTAGE:428 LF 1 TREE/50' LF:9 TREES REQUIRED REQUIRED TREES MAY BE CLUSTERED OR IRREGULARLY SPACED, BUT THE MAXIMUM SPACING OF TREES MAY NOT EXCEED 100 FEET ON-CENTER. VEGETATIVE MATERIAL USED AS A SCREEN MUST HAVE A MINIMUM HEIGHT OF 18 INCHES AT THE TIME OF INSTALLATION, WITH A HEIGHT AT MATURITY OF AT LEAST 3 FEET. PERIMETER PARKING LOT LANDSCAPING PERIMETER PARKING LOT LANDSCAPING MUST BE PROVIDED TO VISUALLY SCREEN PARKING LOTS FROM PUBLIC RIGHTS OF WAY AND FROM ABUTTING RESIDENTIAL ZONING DISTRICTS IN ALL OF THE FOLLOWING CASES: 1. WHEN ANY NEW PARKING LOT IS CONSTRUCTED THAT CONTAINS 10 OR MORE PARKING SPACES OR MORE THAN 3,500 SQUARE FEET OF PAVED AREA; AND 2. WHEN ANY EXISTING PARKING LOT IS EXPANDED TO CREATE 10 OR MORE NEW PARKING SPACES OR MORE THAN 3,500 SQUARE FEET OF ADDITIONAL PAVED AREA. TOTAL PERIMETER PARKING SHRUBS PROPOSED:99 SHRUBS INTERIOR PARKING LOT LANDSCAPING REQUIREMENTS INTERIOR PARKING LOT LANDSCAPING MUST BE PROVIDED IN THE FORM OF AT LEAST ONE SHADE TREE AND 4 SHRUBS PER 10 PARKING SPACES. TOTAL SPACES PROPOSED:17 SHRUBS REQUIRED/PROPOSED:7 SHRUBS TREE REQUIRED/PROPOSED: 2 TREES TREES AND LANDSCAPE MATERIAL LOCATED OUTSIDE THE PERIMETER OF THE PARKING LOT MAY NOT BE COUNTED TOWARD SATISFYING INTERIOR PARKING LOT LANDSCAPING REQUIREMENTS. TREES AND LANDSCAPE MATERIAL WITHIN THE CORNERS OF THE PARKING LOT MAY BE COUNTED. LANDSCAPE ISLANDS MUST BE DISPERSED SO THAT THE DISTANCE BETWEEN ISLANDS IS NO GREATER THAN 1O PARKING SPACES TREE PRESERVATION: TREE INVENTORY SURVEY REQUIRED IN AREAS "OUTSIDE THE BUILDABLE AREA OF A LOT OR DEVELOPMENT SITE". BUILDABLE AREA = ALL AREAS LOCATED OUTSIDE SETBACKS, R/W'S, EASEMENTS. I.E.- TREE SURVEY REQUIRED WITHIN PROPERTY SETBACK AREAS I.F. TREES DBH OF 12" OR GREATER MUST BE MITIGATED AT 125% OD DBH REMOVED SYMBOL COMMON NAME LATIN NAME QTY. SIZE (AT TIME OF PLANTING)REMARKS TREES SHRUBS GROUNDCOVERS RED MAPLE 2" CAL. 6' HT.MATCH SPECIMEN, STRAIGHT LEADERACER RUBRUM 2 WILLOW OAK 2" CAL. 6' HT.MATCH SPECIMEN, STRAIGHT LEADERQUERCUS PHELLOS 9 INKBERRY HOLLY 3 GAL. 24"-36" HT.FULL TO GROUND, DISEASE FREEILEX GLABRA 44 YAUPON HOLLY ILEX VOMITORIA 55 3 GAL. 24"-36" HT.FULL TO GROUND, DISEASE FREE SEED MIX AS NEEDED FOR STABILIZATION LANDSCAPE PLAN TREE, SHRUB, AND GROUNDCOVER PLANTING – GENERAL NOTES (UNION COUNTY, NC – PLAN SHEET STANDARD) ALL PLANT MATERIAL SHALL CONFORM TO THE LATEST EDITION OF THE AMERICAN STANDARD FOR NURSERY STOCK (ANSI Z60.1) AND SHALL BE NURSERY-GROWN, HEALTHY, AND TRUE TO NAME. ALL TREES, SHRUBS, AND GROUNDCOVERS SHALL BE INSTALLED IN ACCORDANCE WITH GASTON COUNTY UDO, ALL APPLICABLE LANDSCAPE REQUIREMENTS, AND THESE PLANS. PLANT SUBSTITUTIONS ARE NOT ALLOWED WITHOUT WRITTEN APPROVAL FROM THE LANDSCAPE ARCHITECT, ENGINEER, OR THE AUTHORITY HAVING JURISDICTION. ALL PLANTING AREAS SHALL BE FREE OF CONSTRUCTION DEBRIS, ROCKS, AND SPOIL MATERIAL. SOILS SHALL BE LOOSENED AND DE-COMPACTED TO A MINIMUM DEPTH OF 6–8 INCHES PRIOR TO PLANTING. ALL TREES SHALL BE INSTALLED WITH THE ROOT FLARE AT OR NO MORE THAN 1" ABOVE FINISHED GRADE. REMOVE ALL BURLAP, TWINE, AND WIRE FROM THE TOP 1/3 OF THE ROOT BALL. SHRUBS AND GROUNDCOVERS SHALL BE INSTALLED SO THAT THE ROOT CROWN IS LEVEL WITH ADJACENT GRADE. PLANTS SHALL NOT BE INSTALLED DEEPER THAN THEIR ORIGINAL CONTAINER DEPTH. MULCH ALL TREE SAUCERS, SHRUB BEDS, AND GROUNDCOVER AREAS TO A 3-INCH DEPTH (2 INCHES IN GROUND-COVER AREAS). MULCH SHALL BE SHREDDED HARDWOOD OR PINE BARK AND SHALL BE CLEAN, WEED-FREE, AND FREE OF INVASIVE SPECIES. TREES SHALL BE STAKED ONLY IF REQUIRED BY THESE PLANS OR THE SITE CONDITIONS. REMOVE STAKES AND STRAPS AFTER 12 MONTHS. CONTRACTOR SHALL WATER ALL PLANTS IMMEDIATELY AFTER INSTALLATION AND SHALL MAINTAIN ADEQUATE MOISTURE UNTIL FINAL ACCEPTANCE. ALL PLANTING SHALL OCCUR ONLY WHEN SOIL CONDITIONS ARE SUITABLE. ANY PLANT MATERIAL THAT DIES, DECLINES, OR FAILS TO THRIVE SHALL BE REPLACED BY THE CONTRACTOR AT NO COST TO THE OWNER PRIOR TO FINAL ACCEPTANCE. A MINIMUM ONE-YEAR WARRANTY SHALL APPLY TO ALL TREES, SHRUBS, AND GROUNDCOVERS FROM THE DATE OF FINAL INSTALLATION. CONTRACTOR SHALL VERIFY ALL UTILITY LOCATIONS PRIOR TO EXCAVATION (CALL 811). PLANTING HOLES SHALL NOT BE EXCAVATED WITHIN DESIGNATED UTILITY EASEMENTS WITHOUT PRIOR APPROVAL. ALL PLANTING BEDS SHALL RECEIVE A WEED-FREE, 3-INCH SOIL AMENDMENT INCORPORATION WHERE SHOWN OR REQUIRED TO IMPROVE SOIL STRUCTURE AND DRAINAGE. CONTRACTOR SHALL PROTECT EXISTING TREES AND SITE FEATURES DURING CONSTRUCTION. ANY DAMAGE SHALL BE REPAIRED OR REPLACED AT THE CONTRACTOR’S EXPENSE. FINAL PLANTING LOCATIONS MAY BE ADJUSTED UP TO 24 INCHES TO AVOID OBSTRUCTIONS, MAINTAIN PROPER SPACING, AND IMPROVE VISUAL ALIGNMENT, SUBJECT TO APPROVAL. ALL TREES ADJACENT TO STREETS SHALL BE PLANTED OUTSIDE OF SIGHT TRIANGLES AND SHALL MEET GASTON COUNTY SIGHT DISTANCE REQUIREMENTS. TURF AREAS ADJACENT TO PLANTING BEDS SHALL BE SMOOTHLY TRANSITIONED TO MATCH EXISTING GRADE AND SHALL DRAIN FREELY AWAY FROM STRUCTURES. ALL PLANTING WORK SHALL BE PERFORMED BY QUALIFIED PERSONNEL EXPERIENCED IN LANDSCAPE INSTALLATION. UTILITY-RELATED REQUIREMENTS CONTRACTOR SHALL CONTACT NORTH CAROLINA 811 PRIOR TO ANY EXCAVATION. ALL UTILITIES SHALL BE FIELD-LOCATED AND MARKED BEFORE ANY PLANTING HOLES ARE DUG. CONTRACTOR SHALL HAND-DIG ALL PLANTING HOLES WITHIN 5 FEET OF ANY MARKED UNDERGROUND UTILITY. AUGERING IS NOT PERMITTED NEAR UTILITIES. NO TREE SHALL BE PLANTED WITHIN 10 FEET OF ANY UNDERGROUND UTILITY LINE (WATER, SEWER, ELECTRIC, GAS, FIBER, OR COMMUNICATION) UNLESS APPROVED BY THE ENGINEER AND UTILITY OWNER. NO TREE SHALL BE PLANTED DIRECTLY ABOVE WATER OR SEWER SERVICE LATERALS. SHRUBS AND GROUNDCOVERS MAY BE USED ONLY IF ROOT SYSTEMS ARE NON-INVASIVE. NO PLANT MATERIAL SHALL BE INSTALLED WITHIN UTILITY EASEMENTS WITHOUT PRIOR WRITTEN APPROVAL OF THE UTILITY OWNER AND AUTHORITY HAVING JURISDICTION. WHERE PLANTED IN APPROVED EASEMENTS, THE OWNER ACCEPTS RISK OF DAMAGE OR REMOVAL DURING FUTURE UTILITY WORK. MAINTAIN REQUIRED CLEARANCES FROM OVERHEAD UTILITIES. UNDER POWER LINES, SELECT ONLY TREE SPECIES THAT MATURE BELOW THE UTILITY HEIGHT AS APPROVED BY THE LOCAL ELECTRIC UTILITY. CONTRACTOR SHALL NOTIFY THE ENGINEER IMMEDIATELY IF A CONFLICT BETWEEN PLANT MATERIAL AND UTILITIES IS DISCOVERED SO THAT FIELD ADJUSTMENTS CAN BE MADE. SITE & INSTALLATION REQUIREMENTS FINAL PLANT LOCATIONS MAY BE SHIFTED UP TO 24 INCHES TO AVOID OBSTRUCTIONS, UTILITIES, OR CONFLICTS WHILE MAINTAINING THE INTENT OF THE DESIGN. MAINTAIN ALL REQUIRED SIGHT TRIANGLE CLEARANCES. NO SHRUBS EXCEEDING 30" MATURE HEIGHT SHALL BE INSTALLED WITHIN SIGHT TRIANGLES. CONTRACTOR SHALL PROTECT EXISTING TREES, ROOT ZONES, AND SITE FEATURES FROM DAMAGE THROUGHOUT CONSTRUCTION. ANY DAMAGE SHALL BE REPAIRED AT THE CONTRACTOR’S EXPENSE. TURF AREAS ADJACENT TO PLANTING BEDS SHALL BE GRADED TO PROVIDE SMOOTH TRANSITIONS AND POSITIVE DRAINAGE AWAY FROM STRUCTURES. ALL WORK SHALL BE PERFORMED BY QUALIFIED LANDSCAPE INSTALLATION PERSONNEL. 47 Application for Conditional Rezoning General Information Project Address o South Rocky River Rd City Monroe Union County Planning Department 500 N Main Street -Suite 70 Monroe, NC 28112 T 704.283.3565 E UCPlanning@unioncountync.gov State North Carolina Zip 28112 Tax Parcel ID 0938401 3 Current Zoning Designation __ R _A _-4_0 ____ Total Acres 1 7.21 (will be Proposed Zoning Designation Light Industrial Date Submitted 31312026 subdividing and rezoning 5.75 ac) Contact Information Applicant Name_J_e _re _m_y _M_c_A_t _ee_r __________________________ _ City Monroe State North Carolina Zip_2_8 _1 _1 2 ___ _ Address 111 5 McAteer Rd Phone 704-282-0788 Fax ___________ Email __________ _ Prop erty Owner Name MCATEER JEREMY D TRUSTEE ET AL MCATEER AMBER L TRUSTEE Address 1115 M cAteer Rd City Monroe State Nor t h Carolina Zip_2 _81_1 _2 ___ _ Phone 704-282-0788 Fax Email ---------------------- 7'/3 (2. C Date .Tf_,�� Iv! <f/t,,�..­ Printe Name/Title r's C�J:ifi�ati9,9/!,9clude names and signatures of all owners) ------7'-,,�- � /'/'� 3/s/c� Str-e.vnt, !M.GA���r-ignature D'ate� PrintedName/Title A vv.b -er r-A "'1t t-c---e-� Union Count� Office Use Only: Case Number: UJ7..Jo-C2 ,.. Cf.J"'{' Date Received:_S_-�3�-_Zlo _________ _ Amount of Fee:'t\DD:::, Fee Ok: @;� Received by:_��0\ _________ _ Contact Bjorn Hansen to begin the process. T. 704.283.2690 E. Bjorn.hansen@unioncountync.gov **This document is only valid from July 1, 2025 -June 30, 2026 48 49 BOCC Motions for Proposed Amendment to the Union County Zoning Map (CZ-2026-005) The Union County Land Use Board recommended that the Union County Board of Commissioners approve the rezoning petition (CZ-2026-005) submitted by Jeremy McAteer, requesting a revision of the Union County Zoning Map by rezoning a 5.75 acre portion of one parcel totaling approximately 17.21 acres appearing on the tax map as tax parcel 09-384-013 on South Rocky River Road from RA-40 to Light Industrial (LI) with Conditions. TO APPROVE THE PROPOSED AMENDMENT (THE PROPOSAL IS CONSISTENT WITH THE CURRENT PLAN) Motion (i) Adopt the Ordinance Approving Revision to the Official Zoning Map of Union County, North Carolina, and (ii) adopt the consistency and reasonableness statement for approval. TO DENY THE PROPOSED AMENDMENT (THE PROPOSAL IS INCONSISTENT WITH THE CURRENT PLAN) Motion (i) Deny rezoning petition CZ-2026-005 from Jeremy McAteer; and (ii) adopt the consistency and reasonableness statement for denial. 50 Statements of Consistency and Reasonableness for Proposed Amendment to the Union County Zoning Map The Union County Land Use Board recommended that the Union County Board of Commissioners approve the rezoning petition (CZ-2026-005) submitted by Jeremy McAteer, requesting a revision of the Union County Zoning Map by rezoning a 5.75 acre portion of one parcel totaling approximately 17.21 acres appearing on the tax map as tax parcel 09-384-013 on South Rocky River Road from RA-40 to Light Industrial (LI) with Conditions. CONSISTENCY AND REASONABLENESS STATEMENT FOR APPROVAL OF THE PROPOSED AMENDMENT (THE PROPOSAL IS CONSISTENT WITH THE CURRENT PLAN) (CZ-2026-005) Pursuant to N.C.G.S. § 160D-605, the Union County Board of Commissioners (the “Board”) does hereby find and determine that adoption of the proposed map amendment is consistent with the currently adopted Union County Comprehensive Plan (the “Plan”). The adoption of the proposed map amendment (i) takes into account the need to amend the zoning map to meet the needs of the community, and (ii) is reasonable and in the public interest because: 1. The proposed use is consistent with the Plan. The Plan’s Land Use Map identifies this area as Employment Corridor overlay. The Plan provides that a variety of employment uses may be appropriate in an Employment Corridor. Such uses that may be appropriate include, without limitation, distribution, logistics, aeronautics, industrial, and agri- business. A rezoning to Light Industrial would allow for many of these development uses contemplated for an Employment Corridor under the Plan. 2. The parcel of land is a larger parcel (over five acres) and is reasonable in size for the proposed zoning district. 3. An immediately adjacent property is already zoned as Light Industrial, as well as legally non-conforming commercial uses immediately north of the proposed use. 4. The benefits to the community at large, the neighbors, and the property owners of the proposed rezoning outweigh any detriments to the neighbors and others caused by the rezoning. The benefits of this rezoning include potentially allowing for increased employment or business uses for the surrounding community to utilize, as well as developing an area designated in the Plan for development immediately adjacent to a significant transportation corridor in the County. The potential detriments of the proposed rezoning, depending upon the allowed use utilized in the proposed zoning district, include any increased noise, light, and traffic exposure from the use that could affect nearby properties. 51 CONSISTENCY AND REASONABLENESS STATEMENT FOR DENIAL OF THE PROPOSED AMENDMENT (THE PROPOSAL IS INCONSISTENT WITH THE CURRENT PLAN) (CZ-2026-005) Pursuant to N.C.G.S. § 160D-605, the Union County Board of Commissioners (the “Board”) does hereby find and determine that this rezoning petition is inconsistent with the Union County Comprehensive Plan (the “Plan”) and that denial of the proposed map amendment is reasonable and in the public interest because: 1. Future allowed uses on the property under certain uses allowed in Light Industrial districts could result in increased congestion on the roads and streets adjacent and nearby to the property. Traffic congestion is a noted concern in the Plan. 2. The property is within a Water Supply Watershed, which limits development intensity in order to protect the City of Monroe’s water supply. The proposed use would increase development intensity on an existing undeveloped parcel. Supporting safe drinking water is noted under the Plan. 3. The proposed rezoning may facilitate ongoing and potential future industrial uses in close proximity to existing residential uses, including residential uses in nearby areas identified as Rural Residential. 52 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-335 Agenda Date:6/16/2026 TITLE:..title Public Hearing - Conveyance of County Owned Property in Union County Industrial Park (Project Canopy) INFORMATION CONTACT: Ron Mahle, Economic Development, Director, 980-476-5279 ACTION REQUESTED: Conduct a Public Hearing to consider the conveyance of 60.97 acres located within the Union County Industrial Park along Goldmine Road to McGee Corporation, their subsidiary or affiliated entity, for a new industrial facility. PRIOR BOARD ACTIONS: 1) October 20, 2025, Regular Meeting, Agenda Item #25-624 - Public Hearing Conducted for consideration of Step 4 Economic Development Incentive Grant to McGee Corporation 2) October 20, 2025, Regular Meeting, Agenda Item #25-626 - Step 4 Economic Development Incentive Grant was awarded to McGee Corporation in an amount-not-to-exceed $696,00 paid over a 5-year period beginning in FY 2028 3) December 8, 2025, Regular Meeting, Agenda Item #25-748 - Public Hearing for consideration of conveyance of county owned property 4) December 8, 2025, Regular Meeting, Agenda Item #25-749 - Consideration of conveyance of county owned property. BACKGROUND: The Union County Economic Development Department started conversations with McGee Corporation under codename Project Canopy in late 2024 about the potential relocation of their manufacturing operation from Stallings, North Carolina, to a 60.97-acre parcel located off Goldmine Road. The company has previously submitted an offer of $4,267,900.00, being $70,000 per acre. However, there are certain conditions existing on the land, which has reduced this offer to $4,136,650.00. The land sought by the company was previously acquired by Union County for an industrial park or to be held for resale for industrial or commercial use, for an industrial or commercial project, pursuant to G.S. 158-7.1 (the specific parcel considered for sale is Union County Tax Parcel #09372003D). McGee Corporation’s purchase of this land is in concert with the County’s economic development objectives, which are the stimulation of the local economy, growth of the tax base, promotion of business, and creation of job opportunities within Union County. The purchase consideration is $4,136,650.00 in cash, subject to all easements, right of ways, encroachments, and other restrictions of record. The Board of Commissioners has determined that the property subject to conveyance, with consideration of certain conditions existing on the land, has a fair market value of $4,136,650.00. Union County, NC Printed on 6/1/2026Page 1 of 2 powered by Legistar™53 File #:26-335 Agenda Date:6/16/2026 The land will be used for an industrial project with an approximate investment of $40,000,000 and the creation of 35 new jobs with a probable hourly wage of $30.28 per hour for employees on the property. McGee Corporation intends to build a new 366,000 square-foot manufacturing facility on the property which will serve as its headquarters for design, sales, manufacturing, and distribution. This sale is made pursuant to private negotiation under G.S. 158-7.1 FINANCIAL IMPACT: Union County would receive $4,136,650.00 in cash in exchange for the land. The project would also bring a prospective $40,000,000 in new capital investment and at least 35 new jobs earning a probable wage of $30.28 per hour into Union County. Union County, NC Printed on 6/1/2026Page 2 of 2 powered by Legistar™54 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-339 Agenda Date:6/16/2026 TITLE:..title Service Award Recognition INFORMATION CONTACT: Jennifer Davis, Human Resources, Assistant Director, 704-283-3803 ACTION REQUESTED: Short video will play to recognize employee service award recipients for Q2 including April, May, and June. PRIOR BOARD ACTIONS: None. BACKGROUND: The employee recognition program acknowledges employees for full-time continuous service at the following intervals: 5 years, 10 years, 15 years, 20 years, 25 years and 30 years of service. We would like to recognize the following employees for full-time continuous service with Union County Local Government. FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™55 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-345 Agenda Date:6/16/2026 TITLE:..title Write Off - FY26 Water & Sewer Delinquent Balances INFORMATION CONTACT: Amy McCaskill, UC Water - Utility Business Services, Director, 704-283-3508 ACTION REQUESTED: Approve the write-off of uncollectible water and sewer accounts as needed. PRIOR BOARD ACTIONS: None. BACKGROUND: N.C.G.S 25-2-725(1) and 1-52(1) place a statute of limitations on how far back delinquent water, sewer, and solid waste account balances can be collected. Water accounts can be collected up to 4 years past their final bill date while sewer accounts can only be collected up to 3 years past their final bill date. Any outstanding account balances past those dates are considered to be write-offs defined as the elimination of uncollectible accounts receivable recorded on the general ledger. The included attachment, for 1,139 water and sewer accounts totaling $157,526.65 denotes the information for FY2026. FINANCIAL IMPACT: There will be a reduction in the accounts receivable balances for Union County Water of $157,526.65. This will also be shown as a corresponding expense to the enterprise fund uncollectable accounts. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™56 Union County Water Street Address City, State ZIP T 555.555.5555 unioncountync.gov/water To: Union County Board of Commissioners From: Amy McCaskill, Director, Utility Business Services Date: 6/16/2026 Re: Uncollectible Water and Sewer Accounts Beginning July 1, 2013, the Union County Tax Collector’s office assumed the responsibility for managing the delinquent account balances for Union County Public Works’ final billed water and sewer accounts. To the extent allowed by the North Carolina General Statutes, the Tax Collector’s office has been collecting these outstanding account balances through the same processes used to collect delinquent tax bills. In Fiscal Year 2015, Union County Public Works contracted with a third- party collection agency to continue collection efforts after the Tax Collector’s office has exhausted all options available to them. In July of 2021, the Deputy Tax Collector FTE was transferred underneath Union County Water Business Operations. The North Carolina General Statutes clearly define the time frame for which delinquent utility bills can be collected. N.C.G.S 25-2-725(1) specifies that water account balances can be collected up to four years past the final bill date. Likewise, N.C.G.S 1-52(1) specifies that sewer account balances can be collected up to three years past the final bill date. This means that delinquent balances remaining on water accounts that were final billed prior to July 1, 2022 and on sewer accounts that were final billed prior to July 1, 2023 are deemed uncollectible as of July 1, 2026 and should be removed from Union County Water’s accounts receivable balances. In compliance with these statutes of limitations, we are requesting that the Board of County Commissioners approve the write off of all final billed account balances that fall outside of the previously stated statutes of limitation, excluding any accounts with an active garnishment. The balances to be written off are as follows: FY23 Write Offs % of FY23 Service Charges Water $82,821.76 0.24% Sewer $74,704.89 0.23% Total $157,526.65 I will be glad to answer any further questions you may have regarding this matter. 57 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-326 Agenda Date:6/16/2026 TITLE:..title Financing Letter - New Salem Volunteer Fire Department INFORMATION CONTACT: Patrick Niland, County Manager’s Office, Deputy County Manager, 704-283-3630 ACTION REQUESTED: Authorize Chairman of the Board to sign the attached letter. PRIOR BOARD ACTIONS: None. BACKGROUND: The New Salem Volunteer Fire Department is constructing a new fire station. The Fire Department has secured financing agreement with HomeTrust Bank. As part of the financing documents, the bank requires a letter from Union County, signed by the chair, stating that New Salem Volunteer Fire Department is allowed to provide fire service in Union County, they are in good standing, the fire tax district supports fire operations, and that the department has made the county aware of this financing agreement. FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™58 OFFICE OF THE COMMISSIONERS AND MANAGER 500 N. Main St., Room 921  Monroe, NC 28112  Phone (704)283-3810  Fax (704)282-0121 June 1, 2026 HomeTrust Bank PO Box 10 Asheville, NC 28802-0010 Re: Municipal Lease and Option Agreement between HomeTrust Bank and New Salem Volunteer Fire Department, Inc. I am Chairman of the County Commissioners of Union County. This letter is to advise you that: New Salem Volunteer Fire Department, Inc. is a qualified Volunteer Fire Department, assigned to protect a specific Fire District within the County. In addition, a special ad valorem (fire tax) is assessed on the real property owners of this district. Said tax is to be used exclusively to provide equipment, facilities, and training as is necessary to provide fire protection for said district. Said funds may also be used to upgrade equipment as the need arises. This tax is collected by the County and disbursed by the Finance Office to the Fire Department on a regular basis by the County Finance Officer. The Fire Department is operated and managed by the Board of Directors of the Fire Department and the Officers of said Department. The Department is currently meeting the requirements of their fire service contract. The Fire Department has made us aware of their intention to acquire new capital assets through a Lease Purchase transaction with your firm. Please be advised that the County has no objection to this transaction. Sincerely, __________________________________ Brian Helms, Chairman Union County Board of Commissioners 59 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-347 Agenda Date:6/16/2026 TITLE:..title Contract Renewal - Uninterrupted Power Supply Maintenance INFORMATION CONTACT: Vicki Callicutt, Emergency Communications, Director, 704-283-3550 ACTION REQUESTED: Authorize the County Manager to 1) negotiate and execute an agreement substantially consistent with this agenda item, 2) exercise any renewal or extension term options set forth in the Agreement, and 3) terminate the Agreement if deemed in the best interest of the County, each in the County Manager's discretion. PRIOR BOARD ACTIONS: None. BACKGROUND: Emergency Communications maintains a backup dispatch center at the Government Center and has equipment that requires regular maintenance to ensure uninterrupted operability of 911 operations for Union County agencies and citizens. The Emergency Communications Department has utilized the contractual services of Vertiv Corporation for Uninterrupted Power Supply Maintenance since July 2022. Vertiv Corporation has been effective and efficient in meeting our service needs, and we are requesting to continue this service for an additional year. FINANCIAL IMPACT: The anticipated annual cost for this service is $13,844.26. Funding is available in the adopted FY2026 budget with future expenditures subject to annual BOCC budget appropriation. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™60 Proposal for Service Vertiv Corporation 3/5/2026 UNION COUNTY 500 N MAIN ST MONROE, NC, 28112 Quote – CPQ-1036226 61 Thank you for your interest in Vertiv Corporation. We are pleased to submit the following proposal for your review and consideration. As the rate of change and complexity in your data center increases, Vertiv is the dedicated partner that you need to help you achieve your goals. Please complete all required fields on the signature page and attach your Purchase Order to assist timely order processing. Should you have any questions regarding the proposal, feel free to contact me directly at (704) 364-8877. I look forward to your response and the opportunity to work together to improve your data center investment. Sincerely, Allison Grove 1601 Cross Beam Drive Charlotte NC 28217 PHONE (704) 364-8877 EMAIL agrove@jgblackmon.com 3/5/2026 SIERRA BURTIS UNION COUNTY 500 N MAIN ST MONROE, NC 28112 Email: sierra.burtis@unioncountync.gov 62 Total price not including tax: $13,844.26 any tax required must be included in customer purchase order Payment Terms: Net 30 Days Quote – CPQ-1036226 Liebert UPS / Power / Battery Services: • We are the Original Equipment Manufacturer and the experts on Liebert equipment with access to updates and changes, knowledge of engineering specifications, current issues and how to fix them correctly. • Our factory trained service force is twice the size of the next largest competitor with over 650 customer engineers and field technicians in the United States alone; everywhere in the US the most knowledgeable engineers and technicians available, will cover you. • With the most advanced tooling and instrumentation available, each CE has over $10,000 in gear with him at all times, so any issue can be resolved in the least amount of time possible. • To make sure we get the right part to the right place at the right time, we have the industry’s most sophisticated parts logistics system. No matter where you are in the US we also have a parts warehouse close to serve you. • We maintain and follow all safety and compliance regulations necessary to keep CE’s from harm and protect you, our customers from liability. We care about your safety. Site#: 1208991 – Union County – 500 N Main St. Monroe, NC 28112 Tag # Description Model # Annual PM Qty. Coverage Type (Coverage Dates) 1993313 EXM 208V 60 47SA060GAC010CS 2 PREFERRED (06/01/2026) - (05/31/2027) 1993314 EXM10-200PERIPH 47MBG37CC0R1S39 0 BASIC (06/01/2026) - (05/31/2027) 1993316 BDSU-50 BDSUI-UXCM 1 PREFERRED (06/01/2026) - (05/31/2027) 1993315 SEALED BATTERY 47BEGWX91S10039 2 PREFERRED (06/01/2026) - (05/31/2027) 1993317 BDSU-50 BDSUI-UXBM 1 PREFERRED (06/01/2026) - (05/31/2027) 63 SCOPE OF WORK BATTERY MONITORING SERVICES BDSU-50 BATTERY DIAGNOSTIC SYSTEM PREFERRED SERVICE - 1 PM SERVICE SUMMARY Feature Detail On-Site Service Includes 1 Preventive Maintenance Service, scheduled by the customer at the customer's convenience (excluding national holidays). Response Time Guaranteed 4-hour on-site emergency response, 7 days/week, 24 hours/day, within 150 miles of a Vertiv Services’ Service City. Customer Support Includes access to the Customer Resolution Center (1-800-543-2378) and the Vertiv Customer Services Network Online Internet portal. Parts Includes 100% parts coverage. Labor & Travel Includes 100% labor and travel coverage 7 days/week, 24 hours/day, within the 48 contiguous states and Hawaii. Service Professional Performed by Vertiv factory trained and authorized technician. Vertiv Services is the OEM service provider for Liebert products. Commissioning Service Includes commissioning service scheduled by the customer at the customers convenience (excluding national holidays). Commissioning includes adjustments to the system after single jar battery replacements and system commissioning after full string replacements (does not include batteries, tab washer installation or installation labor). SERVICE PERFORMED 1. Perform a complete visual inspection of the equipment, including sub-assemblies, wiring harnesses, contacts, cables and major components. 2. Check all nuts, bolts, screws, and connectors for tightness and heat discoloration. 3. Inspect for broken, brittle, damaged, or heat stressed components and cables. 4. Clean any foreign material and dust from internal compartments. 5. Perform any necessary software / firmware upgrades to BDSU-50 unit, if applicable. 6. Maintain and archive battery diagnostic system database. 7. Generate battery health inspection report. ASSUMPTIONS & CLARIFICATIONS  Commissioning does not include batteries, tab washer installation or installation labor 64 CUSTOMER RESPONSIBILITIES In order to provide timely, accurate and thorough execution of the services described herein, Vertiv requests the following:  Point of Contact: Provide an authorized point of contact(s), specific for the scope of work, for scheduling and coordination purposes.  Scheduling: Make dates available for scheduling service. All visits must be requested 10 business days in advance of need by contacting the Vertiv Services Customer Resolution Center at 1-800-543-2378.  Site Access: Prior to time of scheduled work, provide site access including any customer required escort, security clearance, safety training and badging for Vertiv service personnel.  Equipment Access: Convenient access to the equipment covered by the Scope of Work. Prior to scheduled time of work, notify Vertiv service personnel of any special requirements for equipment access including lifts, ladders, etc.  Shutdown: Service may require shutdown of load to ensure electrical connection integrity.  Notification: If for any reason the work cannot be performed during scheduled time, notify Vertiv service personnel 24- hours prior to scheduled event. TERMS AND CONDITIONS Subject to all Terms & Conditions as noted in the Vertiv Services Terms & Conditions or the terms of a Master Agreement between the parties, if any, shall apply. executed June 22, 2022. 65 SCOPE OF WORK BATTERY MONITORING SERVICES BDSI BATTERY DIAGNOSTIC SYSTEM PREFERRED SERVICE - 1 PM SERVICE SUMMARY Feature Detail On-Site Service Includes 1 Preventive Maintenance Service, scheduled by the customer at the customer's convenience (excluding national holidays). Response Time Guaranteed next day response, 7 days/week, 24 hours/day, within 150 miles of a Vertiv’s Service City. Customer Support Includes access to the Customer Resolution Center (1-800-543-2378) and the Vertiv Customer Services Network Online Internet portal. Parts Includes parts coverage (limits may apply; see Assumptions and Clarifications, as applicable, for more details). Labor & Travel Includes 100% labor and travel coverage 7 days/week, 24 hours/day, within the 48 contiguous states and Hawaii. Service Professional Performed by Vertiv factory-trained and authorized technician equipped with Vertiv Proprietary tools and software. Vertiv CEs and Vertiv Partners are the only approved OEM service providers for Vertiv products. Commissioning Service Includes commissioning service scheduled by the customer between 8am-5pm, Monday-Friday (excluding national holidays). Commissioning includes adjustments to the system after single jar battery replacements and system commissioning after full string replacements (does not include batteries, tab washer installation or installation labor). SERVICE PERFORMED 1. Perform a complete visual inspection of the equipment, including sub-assemblies, wiring harnesses, contacts, cables and major components. 2. Check all nuts, bolts, screws, and connectors for tightness and heat discoloration. 3. Inspect for broken, brittle, damaged, or heat stressed components and cables. ASSUMPTIONS AND CLARIFICATIONS Commissioning does not include batteries, tab washer installation or installation labor CUSTOMER RESPONSIBILITIES In order to provide timely, accurate and thorough execution of the services described herein, Vertiv requests the following: • Point of Contact: Provide an authorized point of contact(s), specific for the scope of work, for scheduling and coordination purposes. 66 • Scheduling: Make dates available for scheduling service. All visits must be requested 10 business days in advance of need by contacting the Vertiv Customer Resolution Center at 1-800-543-2378. • Site Access: Prior to time of scheduled work, provide site access including any customer required escort, security clearance, safety training and badging for Vertiv service personnel. • Equipment Access: Convenient access to the equipment covered by the Scope of Work. Prior to scheduled time of work, notify Vertiv service personnel of any special requirements for equipment access including lifts, ladders, etc. • Shutdown: Service may require shutdown of load to ensure electrical connection integrity. • Notification: If for any reason the work cannot be performed during scheduled time, notify Vertiv service personnel 24- hours prior to scheduled event. TERMS AND CONDITIONS Subject to all Terms & Conditions as noted in the Vertiv Terms & Conditions or the terms of a Master Agreement between the parties, if any, shall apply. executed June 22, 2022. 67 SCOPE OF WORK UNINTERRUPTIBLE POWER SYSTEMS EXM UPS ONLY PREFERRED SERVICE - 2 PM SERVICE SUMMARY Feature Detail On-Site Service Includes 1 Annual and 1 Semi-Annual Preventive Maintenance Services on Vertiv UPS and Vertiv internal batteries scheduled by the customer at the customer’s convenience (excluding national holidays). Response Time Guaranteed 4-hour on-site emergency response, 7 days/week, 24 hours/day, within 150 miles of a Vertiv Services’ Service City. Customer Support Includes access to the Customer Resolution Center (1-800-543-2378) and the Vertiv Customer Services Network Online Internet portal. Parts Includes parts coverage (limits may apply; see Assumptions and Clarifications, as applicable, for more details). Internal Battery Coverage Includes parts, labor, disposal and battery jars as required - up to 10% of the battery jars per year, not accumulated over contract term (limits may apply; see Assumptions and Clarifications, as applicable, for more details). Labor & Travel Includes 100% labor and travel coverage 7 days/week, 24 hours/day, within the 48 contiguous states and Hawaii. Service Professional Performed by Vertiv factory trained and authorized technician. Vertiv Services is the OEM service provider for Liebert products. Battery Recycling Includes battery recycling as required, with documentation meeting EPA requirements. SERVICE PERFORMED UPS Full Preventive Maintenance Service Semi-Annual Service 1. Perform a temperature check on all breakers, connections and associated controls. Repair and/or report all high temperature areas. 2. Perform a complete visual inspection of the equipment, including sub-assemblies, wiring harnesses, contacts, cables and major components. 3. Check air filters for cleanliness. (if applicable) 4. Record all voltage and current meter readings on the display. Annual Service (includes the above, plus) 1. Check all nuts, bolts, screws, and connectors for tightness and heat discoloration. 2. With customer approval, perform operational test of the system including unit transfer and battery discharge. 3. Calibrate and record all electronics to system specifications. 68 4. Check or perform Engineering Field Change Notices (FCN) as necessary. 5. Record phase-to-phase input voltage and currents. 6. Review system performance with customer to address any questions and to schedule any repairs. Internal Battery Full Preventive Maintenance Service (applicable to EXM models with internal batteries only) Semi-Annual Service 1. Inspect the appearance and cleanliness of the battery and the battery room. Clean normal cell top dirt accumulation (to be done only with battery off line). 2. Measure and record the total battery float voltage and charging current. 3. Measure and record overall AC ripple current. 4. Measure and record overall AC ripple voltage. 5. Visually inspect the jars and covers for cracks and leakage. 6. Visually inspect for evidence of corrosion. 7. Measure and record ambient temperature. 8. Verify the condition of the ventilation equipment, if applicable. 9. Verify the integrity of the battery rack/cabinet. 10. Measure and record 100% of the cell temperatures. 11. Measure and record the float voltage of all cells. 12. Measure and record all internal impedance readings. 13. Provide a detailed written report noting any deficiencies and corrective action needed, taken and/or planned. Annual Service (includes the above, plus) 1. Re-tighten all battery connections to the battery manufacturer's specifications, offline only. Corrective Maintenance Performed as Required 1. Refurbish cell connections as deemed necessary by the detailed inspection report. ASSUMPTIONS AND CLARIFICATIONS Parts coverage excludes air filters, proactive full bank capacitor replacement and fan replacement. Customer should check air filters monthly for cleanliness and replace as necessary. Maintenance does not include System Control Cabinet, Power Tie, Breaker Cabinets, Load Bus Sync or Maintenance Bypass Cabinets. All battery checks are recorded through the Field DB reporting system. Only visual battery inspection and total battery voltages are to be recorded on the UPS E-form. The full battery maintenance inspection will be conducted through Field DB. CUSTOMER RESPONSIBILITIES In order to provide timely, accurate and thorough execution of the services described herein, Vertiv requests the following: • Point of Contact: Provide an authorized point of contact(s), specific for the scope of work, for scheduling and coordination purposes. • Scheduling: Make dates available for scheduling service. All visits must be requested 10 business days in advance of need by contacting the Vertiv Services Customer Resolution Center at 1-800-543-2378. 69 • Site Access: Prior to time of scheduled work, provide site access including any customer required escort, security clearance, safety training and badging for Vertiv service personnel. • Equipment Access: Convenient access to the equipment covered by the Scope of Work. Prior to scheduled time of work, notify Vertiv service personnel of any special requirements for equipment access including lifts, ladders, etc. • Shutdown: Service may require shutdown of load to ensure electrical connection integrity. • Notification: If for any reason the work cannot be performed during scheduled time, notify Vertiv service personnel 24- hours prior to scheduled event. TERMS AND CONDITIONS Subject to all Terms & Conditions as noted in the Vertiv Services Terms & Conditions or the terms of a Master Agreement between the parties, if any, shall apply. executed June 22, 2022. 70 SCOPE OF WORK UNINTERRUPTIBLE POWER SYSTEMS PERIPHERALS MAINTENANCE BYPASS CABINET MODULE BATTERY DISCONNECT, LOAD BUS SYNC, POWER TIE, SLIM LINE DISTRIBUTION CABINET BASIC SERVICE SERVICE SUMMARY Feature Detail On-Site Service Includes a Performance Evaluation inspection performed immediately after the completion of an emergency visit. Response Time Guaranteed 4-hour on-site emergency response, 7 days/week, 24 hours/day, within 150 miles of a Vertiv Services’ Service City. Customer Support Includes access to the Customer Resolution Center (1-800-543-2378) and the Vertiv Customer Services Network Online Internet portal. Parts Includes parts coverage (limits may apply; see Assumptions and Clarifications, as applicable, for more details). Labor & Travel Includes 100% labor and travel coverage 7 days/week, 24 hours/day, within the 48 contiguous states and Hawaii. Service Professional Performed by Vertiv factory trained and authorized technician. Vertiv Services is the OEM service provider for Liebert products. SERVICE PERFORMED 1. Perform a complete visual inspection of the equipment including internal sub-assemblies, wiring harnesses, contactors, cables, major components, and check for proper clearance around the unit. 2. Check all mechanical connections for tightness and heat discoloration, making corrections where necessary. 3. Perform a status check of alarm circuits. 4. Perform a basic operational test of the system. 5. Review system performance with customer to address any system questions. ASSUMPTIONS AND CLARIFICATIONS Includes 100% parts coverage, excluding circuit breakers and switches. CUSTOMER RESPONSIBILITIES In order to provide timely, accurate and thorough execution of the services described herein, Vertiv requests the following:  Point of Contact: Provide an authorized point of contact(s), specific for the scope of work, for scheduling and coordination purposes. 71  Scheduling: Make dates available for scheduling service. All visits must be requested 10 business days in advance of need by contacting the Vertiv Services Customer Resolution Center at 1-800-543-2378.  Site Access: Prior to time of scheduled work, provide site access including any customer required escort, security clearance, safety training and badging for Vertiv service personnel.  Equipment Access: Convenient access to the equipment covered by the Scope of Work. Prior to scheduled time of work, notify Vertiv service personnel of any special requirements for equipment access including lifts, ladders, etc.  Shutdown: Service may require shutdown of load to ensure electrical connection integrity.  Notification: If for any reason the work cannot be performed during scheduled time, notify Vertiv service personnel 24- hours prior to scheduled event. TERMS AND CONDITIONS Subject to all Terms & Conditions as noted in the Vertiv Services Terms & Conditions or the terms of a Master Agreement between the parties, if any, shall apply. executed June 22, 2022. 72 SCOPE OF WORK STATIONARY BATTERY SYSTEMS SEALED VRLA BATTERY PREFERRED SERVICE - 2 PM SERVICE SUMMARY Feature Detail On-Site Service Includes 1 Quarterly, 1 Annual Preventive Maintenance Services, scheduled by the customer at the customer's convenience (excluding national holidays). Response Time Guaranteed 4-hour on-site emergency response, 7 days/week, 24 hours/day, within 150 miles of a Vertiv’s Service city. Customer Support Includes access to the Customer Resolution Center (1-800-543-2378) and the Vertiv Customer Services Network Online Internet portal. Internal Battery Coverage Includes parts, labor, disposal and battery jars as required - up to 10% of the battery jars per year, not accumulated over contract term (limits may apply; see Assumptions and Clarifications, as applicable, for more details). Labor & Travel Includes 100% labor and travel coverage. Service Professional Performed by Vertiv factory-trained and authorized technician equipped with Vertiv Proprietary tools and software. Vertiv CEs and Vertiv Partners are the only approved OEM service providers for Vertiv products. Battery Recycling Includes battery recycling as required, with documentation meeting EPA requirements. SERVICE PERFORMED **Annual Service PM is recommended for the initial PM visit.** Quarterly Service 1. Inspect the appearance and cleanliness of the battery and the battery room. Clean normal cell top dirt accumulation (to be done only with battery off line). 2. Measure and record the total battery float voltage and charging current. 3. Measure and record overall AC ripple voltage. 4. Measure and record overall AC ripple current. 5. Visually inspect the jars and covers for cracks and leakage. 6. Visually inspect for evidence of corrosion. 7. Measure and record the ambient temperature. 8. Verify the condition of the ventilation equipment, if applicable. 9. Verify the integrity of the battery rack/cabinet. 10. Measure and record 100% of the cell temperatures. 73 11. Measure and record the float voltage of all cells. 12. Measure and record all internal Ohmic values. 13. Provide a detailed written report noting any deficiencies and corrective action needed, taken, and/or planned. Annual Service (plus Quarterly Service)  Re-tighten all connections to the battery manufacturer's specifications, if applicable. Refer to the manufacturer’s literature to determine if re-tightening is required.  Measure and record all battery connection Ohmic values, when applicable.  Measure and record 100% of the cell temperatures. Corrective Maintenance Performed as Required 1. Refurbish cell connections as deemed necessary by the detailed inspection report. 2. Minor repairs to battery systems occurring during the contract period will be covered by the contract. Conditions for Single Jar Replacement Service for Lead Acid Batteries  The Customer is covered by an Essential or Preferred Contract.  The battery string is in overall good health as determined by Vertiv; the battery string is not beyond expected service years or has had excessive single jar replacements that would make the string unstable.  Up to 10% of defective battery jars may be replaced within a 12-month period as exclusively determined by Vertiv Services.  Contracts have no cash value for future years or full string battery replacements. Single jar replacement is limited to batteries in the original string. CUSTOMER RESPONSIBILITIES In order to provide timely, accurate and thorough execution of the services described herein, Vertiv requests the following: • Point of Contact: Provide an authorized point of contact(s), specific for the scope of work, for scheduling and coordination purposes. • Scheduling: Make dates available for scheduling service. All visits must be requested 10 business days in advance of need by contacting the Vertiv Customer Resolution Center at 1-800-543-2378. • Site Access: Prior to time of scheduled work, provide site access including any customer required escort, security clearance, safety training and badging for Vertiv service personnel. • Equipment Access: Convenient access to the equipment covered by the Scope of Work. Prior to scheduled time of work, notify Vertiv service personnel of any special requirements for equipment access including lifts, ladders, etc. • Shutdown: Service may require shutdown of load to ensure electrical connection integrity. • Notification: If for any reason the work cannot be performed during scheduled time, notify Vertiv service personnel 24- hours prior to scheduled event. TERMS AND CONDITIONS Subject to all Terms & Conditions as noted in the Vertiv Terms & Conditions or the terms of a Master Agreement between the parties, if any, shall apply.executed June 22, 2022. 74 Order Number: CPQ-1036226 Purchase Order must be assigned to: Payment remittance address: Vertiv Corporation Vertiv Corporation 505 N. Cleveland Avenue PO Box 70474 Westerville, OH 43082 Chicago, IL 60673 FID# 31-0715256 PO should be e-mailed or faxed with signed proposal to: Vertiv Corporation c/o Allison Grove Attn: Allison Grove Email: agrove@jgblackmon.com Please complete the following information (All fields are required): Purchase Order Number: ____________________________ Purchase Order attached:  Yes  No If PO NOT attached, please specify reason: __________________________________________________________ Invoice Delivery Method:  Web Billing (Attach Instructions)  Mail  Other_____________________________ Accounts Payable Email ______________________@___________________________ Billing Contact Person: _______________________________ Phone: ____________________________________ Email: ____________________________________________ Fax #: _____________________________________ Bill-To Company Name: ______________________________ Bill-To Address: _____________________________ Federal Tax ID # ____________________________________ Bill-To City, ST Zip: __________________________ Tax Exempt:  Yes (Attach tax exempt certificate)  No Site Services/IT Contact Person:________________________ Phone: ____________________________________ * * COVERAGE DETAILS * * For equipment not currently under a Service Agreement or for equipment for which the warranty has expired in excess of thirty (30) days, parts required to bring equipment back to manufacturers specifications are the responsibility of the Buyer and billable at the time of the first preventive maintenance visit or Service call. All pricing is valid only for Service coverage stated and is subject to change if this Proposal is modified in any way. This Proposal is valid for ninety (90) days from the date of this Proposal unless otherwise noted. INFORMATION TO BUYER: This order between the Buyer and Seller is limited to Seller’s Terms and Conditions located at termsconditions.vertivco.com unless a formal agreement governing this Purchase Order/transaction has been executed by the parties, in which case the Terms and Conditions of the signed agreement shall govern. Seller hereby objects to all Buyer’s terms and conditions received by Seller and/or issued by Buyer. Signature of this agreement authorizes Seller to invoice for Services mentioned herein and to utilize the provided purchase order number. If a purchase order number is not used, then the Buyer authorizes and guarantees Seller the payment of such invoices by authority of the signature below. Thank you for your business. Proposed By: Accepted By: ___________________________________ _________________________________________________ Allison Grove Date Buyer Signature Required Date _________________________________________________ Printed Name Title Phone 75 Requirement Details Purchasing Company Information • Provide your Company’s legal name and billing address • For new Customers: o Provide your Company’s W-9 with matching legal name and address o Complete a Credit Application Link if requesting credit Vertiv Name and Address • U.S. Orders: o Vertiv Corporation 505 N. Cleveland Ave, Westerville, OH 43082 • Canadian Orders: o Vertiv Canada ULC #7-3800B Laird Rd., Mississauga, ON L5L 0B2 Canada – OR – 3001, rue Douglas B. Floreani, St. Laurent, QC, H4S 1Y7, Canada Product and/or Services Ordered • Include line-item detail with quantities for each product/service ordered – OR – • Provide an aggregate solution description with a reference to the Vertiv quote number P.O. Order Value • Line level pricing including a total purchase commitment value – OR – • Aggregate / total solution value only Payment Terms • Specify payment terms or include a reference to an executed contract with Vertiv detailing repayment terms Freight Terms • Specify INCOTERMS or Freight terms to define if freight value is included in the P.O. value o Identify who is responsible for freight coordination and when title transfers Tax Status • Orders will be processed as taxable unless a “tax exempt” status is defined on the P.O. and a valid/current tax-exemption certificate is presented with P.O. or already on file with Vertiv Requested Ship Date(s) • Unless expecting immediate or first available shipment date, include specific shipment timing requests Ship to Address(es) • Provide detailed shipping or handling instructions, including address for specific product shipments or service locations Special Order Requirements • Indicate any special requirements or instructions, such as: o Formal approval of Submittals before order acceptance o Milestone Billing details (required either by Customer or Vertiv) o Special sourcing requirements such as DPAS (Defense Prioritization) or BAA (Build America Act) Vertiv Purchase Order Acceptance Requirements: To ensure efficient order processing, Vertiv requests the following information be included with all purchase orders: 76 The Master Services Agreement between Vertiv Corporation and Union County executed June 22, 2022 shall take precedence over the standard terms and conditions. 77 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-333 Agenda Date:6/16/2026 TITLE:..title Grant Application - Sisters of Mercy of North Carolina Legacy INFORMATION CONTACT: Jason May, Budget & Grants Management, Director, 704-283-3760 ACTION REQUESTED: Authorize the County Manager to submit the associated grant application and make necessary assurances and certifications associated with the grant application as substantially consistent with this agenda item, which includes the authorization to execute documents related to award of the grant and budget funds as appropriate. PRIOR BOARD ACTIONS: None. BACKGROUND: The Parenting Support & Nurturing Parenting Program (PSNP) helps families strengthen parenting skills and build healthy, supportive relationships with their children. The program provides intensive parenting education and support services to families experiencing significant parenting challenges, including those at risk of or in the early stages of child maltreatment who may benefit from intervention and treatment services. Established in Union County in 2011, PSNP is funded through the Alliance for Children. Union County has been advised to anticipate a 10% reduction in funding from the Alliance for Children for FY 2027. This grant request is intended to help offset the anticipated funding shortfall and ensure the continuation of this essential program and the services it provides to vulnerable families in the community. The Sisters of Mercy of North Carolina Legacy awards grants to tax-exempt health care, educational, and social service organizations that align with its mission of improving the quality of life for women, children, older adults, and individuals experiencing poverty. The organization prioritizes funding for ongoing operational needs as well as specific program and project expenses that directly support these populations. FINANCIAL IMPACT: The grant request will be for approximately $20,000. There is no match required for this grant. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™78 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-323 Agenda Date:6/16/2026 TITLE:..title NC Department of Public Safety Juvenile Crime Prevention Council Funding Plan FY 2026-2027 INFORMATION CONTACT: Beverly Liles, Finance, Director, 704-283-3675 ACTION REQUESTED: 1) Approve County Funding Allocation Plan, Annual Plan and Certification for FY 2026-2027, 2) authorize the Finance Director to approve the grant agreements and documents related to such grant agreements during their term, and 3) authorize the County Manager to appropriate JCPC Funding as approved in the funding plan by a County Manager's Budget Amendment in FY 2027. PRIOR BOARD ACTIONS: None BACKGROUND: The Juvenile Crime Prevention Council (JCPC) is a Board appointed by Commissioners, as defined by State Statutes. The JCPC provides funding and monitors Community Based alternatives to juvenile incarceration and provides funding for substance abuse prevention strategies and programs. Funding for JCPC programs is generally adopted in the State Budget and assigned to County programs by a formula grant. Normally, a county JCPC approves a budget for the upcoming fiscal year, which is then submitted to the North Carolina Department of Public Safety Juvenile Justice and Delinquency Prevention (the DJJ). The attached funding plan was developed and approved by the JCPC Board and represents the Board's plan for how the funds will be spent for the 2026-2027 fiscal year. This request will be included in the State’s DJJ budget which is planned for 2026-2027. The JCPC Board approved $476,439 for County programs for the 2026-2027 fiscal year. The Funding Plan allocates funding from the State to the following programs: Life Connections D-A-S-H Counseling Services $100,000, Transforming Youth Movement-Transforming Futures $125,000, Transforming Youth Movement- Union County Teen Court Program $40,790, Aspire Youth and Family Kids at Work $75,312, JCPC Administration $9,502, Arts Related Innovative Student Empowerment (ARISE) Union-KRE8IVU $50,000, The Connection Center $45,835, and New Covenant Community Development Center - Next Step Youth Program $30,000. The JCPC budget is normally approved as a "pass through" line item in the County budget, meaning that the amount approved by the State is received by the County and then used for the JCPC program. Union County, NC Printed on 6/1/2026Page 1 of 2 powered by Legistar™79 File #:26-323 Agenda Date:6/16/2026 Union County has not approved JCPC programs in line-item detail in the past; rather, the JCPC Board normally negotiates, approves, and monitors line-item detail within the amount of funds allocated to the program, and provides a recommended budget to Commissioners. FINANCIAL IMPACT: None Union County, NC Printed on 6/1/2026Page 2 of 2 powered by Legistar™80 $229,477 Rate:30% OTHER OTHER # Program Provider DPS-JCPC Funding County Cash Match Local Cash Match Local In- Kind State/ Federal Funds Total % Non DPS-JCPC Program Revenues 1 Life Connections of the Carolinas-DASH Counseling Services $100,000 $31,689 $131,689 24% 2 Transforming Youth Movement, INC- Transforming Futures $125,000 $40,000 $165,000 24% 3 Aspire Youth & Family, Inc-Kids At Work! Union $75,312 $29,388 $104,700 28% 4 Union County-JCPC Administration $9,502 $9,502 5 A.R.I.S.E- Union-Kre8ivu $50,000 $30,000 $80,000 38% 6 The Connect Center $45,835 $50,502 $96,337 52% 7 Transforming Youth Movement-Union County Teen Court Program $40,790 $13,000 $53,790 24% 8 NCCDC Next Step Youth Program $30,000 $2 $34,896 $64,898 54% 9 10 11 12 13 14 15 16 17 18 TOTALS:$476,439 $50,504 $178,973 $705,916 33% County 2026-2027 . Amount of Unallocated Funds Amount of funds reverted back to DPS Chairperson, Juvenile Crime Prevention Council (Date) Discretionary Funds added check type initial plan update final Chairperson, Board of County Commissioners (Date) or County Finance Officer Reviewed by_____________________________________ Area Consultant Date Reviewed by_____________________________________ Program Assistant Date Verified by_____________________________________ Designated State Office Staff Date ver 03/02/21 -----DPS Use Only----- DPS JCPC funds must be committed with a Program Agreement submitted in NC Allies and electronically signed by authorized officials. LOCAL FUNDING The above plan was derived through a planning process by the Union Juvenile Crime Prevention Council and represents the County’s Plan for use of these funds in FY Union County NC DPS - Community Programs - County Funding Plan Available Funds: $$476,439 Local Match: $ initial plan update final 5.14.26 ___________ ______ -----DPS Use Only----- initial plan ____________________________ Program Assistant _________________ Area Consultant 5/14/26             81 :ƵǀĞŶŝůĞƌŝŵĞWƌĞǀĞŶƚŝŽŶŽƵŶĐŝů ŽƵŶƚLJWůĂŶ  Union County For FY 2026-2027 Table of Contents Ǥ š‡…—–‹˜‡—ƒ”›  Ǥ ‘—–› —†‹‰Žƒ  Ǥ —˜‡‹Ž‡”‹‡”‡˜‡–‹‘‘—…‹Ž”‰ƒ‹œƒ–‹‘  Ǥ ‘—–›‹•ǡ‡‡†•ƒ† ••‡••‡–—ƒ”›  Ǥ ‘—–› —˜‡‹Ž‡”‹‡”‡˜‡–‹‘‘—…‹Ž‡“—‡•–ˆ‘””‘’‘•ƒŽ•   Ǥ —†‹‰‡…‹•‹‘•—ƒ”›   Ǥ —†‡†”‘‰”ƒ•Program Enhancement PlanȋȌ‘”ǡƒ††„”‹‡ˆ’”‘‰”ƒ †‡•…”‹’–‹‘ˆ‘”ƒ›’”‘‰”ƒ™‹–Š‘—–ƒǤ   ––ƒ…Š‡–•ǣ x ‹‘‘—–› —†‹‰Žƒ x  ƒ–ƒ x ‡•‡ƒ”…Šƒ•‡†”‘‰”ƒ—ƒ”› x ‹‘‘—–›            82 Executive Summary The Union County Juvenile Crime Prevention Council (JCPC), in fulfillment of the duties and responsibilities as set forth in the General Statutes of the State of North Carolina, has reviewed and updated this County Plan for FY 2026-2027. In 2019, House Bill 593 passed which approved an optional 1 or 2-year funding cycle for DPS JCPC funds, which is determined locally by each JCPC statewide. Also included in the HB was Raise the Age in N.C. which directs 16 & 17 years old from District Court to Juvenile Court. In order to see any new possible trends in juvenile justice data (now serving 16 & 17 year old) and to plan programming in the community accordingly, the Union County JCPC approved a 1 year funding cycle. Data continues to be monitored by the JCPC annually, which provides direction to which funding cycle is most beneficial to the community and Council. The JCPC has identified the issues and factors which have an influence and impact upon vulnerable youth, at-risk youth, delinquent youth, and their families in Union County. Further, the JCPC has identified the strategies and services most likely to reduce/prevent delinquent behavior. Monitoring and Evaluation: Each program funded in the past fiscal year by the JCPC has been monitored by the JCPC Monitoring Committee and programs were found in full compliance with DPS JCPC Policy and within the operating parameters of their budget and providing the services as described in their program agreement. The monitoring results and program outcome evaluations were considered in making funding allocation decisions. The JCPC will continue to conduct annual implementation monitoring of its funded programs. Priorities for Funding: Through a review of risk & needs assessment data, the Youth Assessment Screening Inventory (YASI) data and a community resource assessment, the JCPC has determined that the following services are needed to reduce/prevent delinquency in Union County. 1. School Problem Behaviors 2. Juveniles who associate with other delinquent peers 3. Substance abuse 4. Parenting Skills 5. Mental Health 6. Reduction in juvenile recidivism 7. Gang involvement 8. Weapon possession Funding Recommendations: Having advertised a Request for Proposals (RFP) for these needed services for a minimum of thirty (30) days, the JCPC has screened the submitted proposals and has determined which proposals best meet the advertised needed services. As required by statute, the JCPC recommends allocation of the NC Department of Public, Division of Juvenile Justice and Delinquency Prevention funds to the following programs in the amounts specified below for the upcoming fiscal year: (Also, see the Union County Funding Plan with this report.) If applicable, please note which programs were funded for two years. 1. Life Connections of the Carolinas-DASH Counseling Services $100,00 2. Transforming Youth Movement, INC- Transforming Futures $125,000 3. Aspire Youth & Family, Inc-Kids At Work! Union $75,312 4. Union County-JCPC Administration $9,502 5. A.R.I.S.E- Union-Kre8ivu $50,000 6. The Connect Center $45,835 7. Transforming Youth Movement-Union County Teen Court Program $40,790 8. NCCDC Next Step Youth Program $30,000           83 The JCPC further recommends that the following amount be allocated for the administrative costs of the Council for fiscal year 26-27: $476,439. Respectfully Submitted, __________________________, Chair Union County Juvenile Crime Prevention Council Date: _________________            84 $229,477 Rate:30% OTHER OTHER # Program Provider DPS-JCPC Funding County Cash Match Local Cash Match Local In- Kind State/ Federal Funds Total % Non DPS-JCPC Program Revenues 1 Life Connections of the Carolinas-DASH Counseling Services $100,000 $31,689 $131,689 24% 2 Transforming Youth Movement, INC- Transforming Futures $125,000 $40,000 $165,000 24% 3 Aspire Youth & Family, Inc-Kids At Work! Union $75,312 $29,388 $104,700 28% 4 Union County-JCPC Administration $9,502 $9,502 5 A.R.I.S.E- Union-Kre8ivu $50,000 $30,000 $80,000 38% 6 The Connect Center $45,835 $50,502 $96,337 52% 7 Transforming Youth Movement-Union County Teen Court Program $40,790 $13,000 $53,790 24% 8 NCCDC Next Step Youth Program $30,000 $2 $34,896 $64,898 54% 9 10 11 12 13 14 15 16 17 18 TOTALS:$476,439 $50,504 $178,973 $705,916 33% County 2026-2027 . Amount of Unallocated Funds Amount of funds reverted back to DPS Chairperson, Juvenile Crime Prevention Council (Date) Discretionary Funds added check type initial plan update final Chairperson, Board of County Commissioners (Date) or County Finance Officer Reviewed by_____________________________________ Area Consultant Date Reviewed by_____________________________________ Program Assistant Date Verified by_____________________________________ Designated State Office Staff Date ver 03/02/21 -----DPS Use Only----- DPS JCPC funds must be committed with a Program Agreement submitted in NC Allies and electronically signed by authorized officials. LOCAL FUNDING The above plan was derived through a planning process by the Union Juvenile Crime Prevention Council and represents the County’s Plan for use of these funds in FY Union County NC DPS - Community Programs - County Funding Plan Available Funds: $$476,439 Local Match: $ initial plan update final 5.14.26 ___________ ______ -----DPS Use Only----- initial plan ____________________________ Program Assistant _________________ Area Consultant 5/14/26                       85 Juvenile Crime Prevention Council Organization FY 26-27 Name Organization Title Chairperson :ŽŚŶ<ŝƌŬƉĂƚƌŝĐŬ/sZĞŚŽďŽƚŚŚƵƌĐŚ͖hŶŝŽŶŽƵŶƚLJWƵďůŝĐ ^ĐŚŽŽůƐ ZĞǀĞƌĞŶĚ͖hŶŝŽŶ ŽƵŶƚLJŽĂƌĚŽĨ ĚƵĐĂƚŝŽŶDĞŵďĞƌ Vice- Chairperson :ŝŵŚĂĨĨŝŶ hŶŝŽŶŽƵŶƚLJWĂƌŬƐΘZĞĐƌĞĂƚŝŽŶWĂƌŬƐΘZĞĐƌĞĂƚŝŽŶ ŝƌĞĐƚŽƌ Secretary EͬEͬEͬ Treasurer EĂƚĂƐŚĂ^ƚŽǀĂůůŽƵƌƚŽƵŶƐĞůŽƌ^ƵƉĞƌǀŝƐŽƌ Risk & Needs Committee Chairperson ƌ͘:ĂLJ:ŽŶĞƐhŶŝŽŶŽƵŶƚLJWƵďůŝĐ^ĐŚŽŽůƐ ƐƐŝƐƚĂŶƚ ^ƵƉĞƌŝŶƚĞŶĚĞŶƚŽĨ ^ĐŚŽŽů^ƵƉƉŽƌƚ Funding Committee Chairperson DĂůŝƐŚĂZŽƐƐ;ŽͲŚĂŝƌͿ͖ :ĂŵĞƐ:ŽŚŶƐŽŶ:ƌ͘;ŽͲŚĂŝƌͿWĂƌƚŶĞƌƐĞŚĂǀŝŽƌĂů,ĞĂůƚŚ͖Eͬ ZĞŐŝŽŶĂůŝƌĞĐƚŽƌŽĨ ŽŵŵƵŶŝƚLJKƉĞƌĂƚŝŽŶƐ ŝŶĂďĂƌƌƵƐ͕^ƚĂŶůLJ͕Θ hŶŝŽŶŽƵŶƚŝĞƐ͖ DĞŵďĞƌŽĨƚŚĞ ŽŵŵƵŶŝƚLJ  Number of members for FY 26-27: 24 (Average) List meeting dates during the current fiscal year and identify the number of JCPC members in attendance for each. Meeting Date Number of Members in Attendance Quorum Present? Yes/No ƵŐƵƐƚϭϯ͕ϮϬϮϱϭϬŽƵƚŽĨϭϲzĞƐ ^ĞƉƚĞŵďĞƌϭϬ͕ϮϬϮϱϭϭŽƵƚŽĨϮϯEŽ KĐƚŽďĞƌϴ͕ϮϬϮϱϭϵŽƵƚŽĨϮϯzĞƐ EŽǀĞŵďĞƌϭϮ͕ϮϬϮϱϭϱŽƵƚŽĨϮϯzĞƐ ĞĐĞŵďĞƌϭϬ͕ϮϬϮϱϭϲŽƵƚŽĨϮϰzĞƐ :ĂŶƵĂƌLJϭϰ͕ϮϬϮϲϭϲŽƵƚŽĨϮϰzĞƐ &ĞďƌƵĂƌLJϭϭ͕ϮϬϮϲϭϰŽƵƚŽĨϮϰzĞƐ DĂƌĐŚϮϯ͕ϮϬϮϲϭϰŽƵƚŽĨϮϰzĞƐ           86 Ɖƌŝůϴ͕ϮϬϮϲϭϲŽĨϮϰzĞƐ DĂLJϭϯ͕ϮϬϮϲϭϱŽĨϮϰzĞƐ :ƵŶĞϭϬ͕ϮϬϮϲWĞŶĚŝŶŐWĞŶĚŝŶŐ EŽ:ƵůLJDĞĞƚŝŶŐEͬEͬ           87 -89(1,/(&5,0(35(9(17,21&281&,/&(57,),&$7,2167$1'$5'6 Form JCPC/OP 002 (a) Juvenile Crime Prevention Council Certification Application Form structure last revised June 2024 NC Department of Public Safety *6%DOORZVIRUD\HDUIXQGLQJF\FOHIRUSURJUDPVWKDWPHHWWKHUHTXLUHPHQWVRIWKHVWDWXWHDQGKDYHEHHQ DZDUGHGIXQGVLQDSULRUIXQGLQJF\FOH,QGLFDWHEHORZLIWKH-&3&SODQVWRDOORZIRUD\HDURU\HDUIXQGLQJF\FOH <HDU)XQGLQJ)< 0HPEHUVKLS $ +DYHWKHPHPEHUVRIWKH-XYHQLOH&ULPH3UHYHQWLRQ&RXQFLOEHHQDSSRLQWHGE\FRXQW\FRPPLVVLRQHUV" <HV % $UHPHPEHUVDSSRLQWHGIRUWZR\HDUWHUPVDQGDUHWKRVHWHUPVVWDJJHUHG" <HV & ,VPHPEHUVKLSUHIOHFWLYHRIVRFLDOHFRQRPLFDQGUDFLDOGLYHUVLW\RIWKHFRPPXQLW\" <HV ' 'RHVWKHPHPEHUVKLSRIWKH-XYHQLOH&ULPH3UHYHQWLRQ&RXQFLOUHIOHFWWKHUHTXLUHGSRVLWLRQVDVSURYLGHGE\ 1&*6†%"1R ,IQRWZKLFKSRVLWLRQVDUHYDFDQWDQGZK\" 7KHIROORZLQJ8QLRQ&RXQW\-&3&%RDUG0HPEHU7HUPVDUHH[SHFWHGWRH[SLUHRQ-XQH7KHQRWLFHUHJDUGLQJ WKHXSFRPLQJ%RDUG9DFDQFLHVZDVSRVWHGRQ7KHERDUGLVFXUUHQWO\ZRUNLQJWKURXJKWKH0HPEHUVKLS &RPPLWWHHWRDGGUHVVWKHVHYDFDQFLHV,WKDVEHHQFRQILUPHGWKDWWKHVHSRVLWLRQVKDYHLQWHUHVWHGDSSOLFDQWVLQFOXGLQJ SRVVLEOHUHDSSRLQWPHQWV 2QH  5HSUHVHQWDWLYHIURP8QLWHG:D\RWKHUQRQSURILW 2QH  0HPEHURIWKH)DLWK&RPPXQLW\ 2QH  -XYHQLOH'HIHQVH$WWRUQH\ 7ZR  &RXQW\&RPPLVVLRQHU$SSRLQWHHV 2QH  3DUNV 5HFUHDWLRQ5HSUHVHQWDWLYH 2UJDQL]DWLRQ $ 'RHVWKH-&3&KDYHZULWWHQ%\ODZV"<HV % %\ODZVDUH 2QILOH & %\ODZVFRQWDLQ&RQIOLFWRI,QWHUHVWVHFWLRQSHU-&3&SROLF\DQGSURFHGXUH <HV ' 'RHVWKH-&3&KDYHZULWWHQSROLFLHVDQGSURFHGXUHVIRUIXQGLQJDQGUHYLHZ" <HV ( 7KHVHSROLFLHVDQGSURFHGXUHV 2QILOH ) 'RHVWKH-&3&KDYHRIILFHUVDQGDUHWKH\HOHFWHGDQQXDOO\" <HV 0HHWLQJV $ -&3&PHHWLQJVDUHFRQVLGHUHGRSHQDQGSXEOLFQRWLFHRIPHHWLQJVLVSURYLGHG <HV % ,VDTXRUXPGHILQHGDVWKHPDMRULW\RIPHPEHUVKLSDQGUHTXLUHGWREHSUHVHQWLQRUGHUWRFRQGXFWEXVLQHVVDW -&3&PHHWLQJV"<HV & 'RHVWKH-&3&PHHWVL[  WLPHVD\HDUDWDPLQLPXP" <HV ' $UHPLQXWHVWDNHQDWDOORIILFLDOPHHWLQJV"<HV ( $UHPLQXWHVGLVWULEXWHGSULRUWRRUGXULQJVXEVHTXHQWPHHWLQJV" <HV 3ODQQLQJ $ 'RHVWKH-&3&FRQGXFWDELHQQLDOSODQQLQJSURFHVVZKLFKLQFOXGHVDQHHGVDVVHVVPHQWPRQLWRULQJRI SURJUDPVDQGIXQGLQJDOORFDWLRQSURFHVV"<HV % ,VWKLV%LHQQLDO3ODQSUHVHQWHGWRWKH%RDUGRI&RXQW\&RPPLVVLRQHUVDQGWR'36" <HV & ,VWKH)XQGLQJ3ODQDSSURYHGE\WKHIXOOFRXQFLODQGVXEPLWWHGWR&RPPLVVLRQHUVIRUWKHLUDSSURYDO" <HV 3XEOLF$ZDUHQHVV $ 'RHVWKH-&3&FRPPXQLFDWHWKHDYDLODELOLW\RIIXQGVWRDOOSXEOLFDQGSULYDWHQRQSURILWDJHQFLHVZKLFKVHUYH <HV           88 -89(1,/(&5,0(35(9(17,21&281&,/&(57,),&$7,2167$1'$5'6 Form JCPC/OP 002 (a) Juvenile Crime Prevention Council Certification Application Form structure last revised June 2024 NC Department of Public Safety FKLOGUHQRUWKHLUIDPLOLHVDQGWRRWKHULQWHUHVWHGFRPPXQLW\PHPEHUV" 5)3'LVWULEXWLRQ/LVWDQG$GYHUWLVHPHQWDWWDFKHG % 'RHVWKH-&3&FRPSOHWHDELHQQLDOQHHGVDVVHVVPHQWDQGPDNHWKDWLQIRUPDWLRQDYDLODEOHWRDJHQFLHVZKLFK VHUYHFKLOGUHQRUWKHLUIDPLOLHVDQGWRLQWHUHVWHGFRPPXQLW\PHPEHUV"<HV 1R2YHUGXH7D['HEW $ $VUHFLSLHQWRIWKHFRXQW\'36-&3&DOORFDWLRQGRHVWKH&RXQW\FHUWLI\WKDWLWKDVQRRYHUGXHWD[GHEWVDV GHILQHGE\1&*6†DWWKH)HGHUDO6WDWHRUORFDOOHYHO"<HV %ULHIO\RXWOLQHWKHSODQIRUFRUUHFWLQJDQ\DUHDVRIVWDQGDUGVQRQFRPSOLDQFH 7KHFRXQFLOLVZRUNLQJWKURXJKLWV0HPEHUVKLS&RPPLWWHHWRILOOYDFDQWH[SLULQJVHDWVRQWKHFRXQFLODQGZLOOFRQWLQXHWR DGGUHVVWKLVLQWKHQHZ)LVFDO<HDUXQWLOSRVLWLRQVDUHILOOHG7KH0HPEHUVKLS&RPPLWWHHLVDOVRZRUNLQJRQEHWWHU WUDFNLQJ-&3&PHPEHUV VWDJJHUHGWHUPVDQGGHYHORSLQJZULWWHQSURFHGXUHVIRUDSSRLQWLQJGHVLJQHHPHPEHUVDQGKRZ WRDGGUHVVPXOWLSOHDSSOLFDQWVIRURQHSRVLWLRQ $UHDVRI2SSRUWXQLW\ $GGLWLRQDOFODULW\RIZULWWHQSROLFLHVDQGSURFHGXUHVIRUIXQGLQJDQGUHYLHZLQFOXGLQJUHLPEXUVHPHQWSURFHGXUHV ,PSURYHGWLPHOLQHVVRIPHHWLQJPLQXWHVGLVWULEXWLRQ           89 -89(1,/(&5,0(35(9(17,21&281&,/&(57,),&$7,2167$1'$5'6 Form JCPC/OP 002 (a) Juvenile Crime Prevention Council Certification Application Form structure last revised June 2024 NC Department of Public Safety ,QVWUXFWLRQV1&*6†%VSHFLILHVVXJJHVWHGPHPEHUVEHDSSRLQWHGE\FRXQW\FRPPLVVLRQHUVWRVHUYHRQORFDO -XYHQLOH&ULPH3UHYHQWLRQ&RXQFLOV,QFHUWDLQFDWHJRULHVDGHVLJQHHPD\EHDSSRLQWHGWRVHUYH3OHDVHLQGLFDWHWKH SHUVRQDSSRLQWHGWRVHUYHLQHDFKFDWHJRU\DQGKLVKHUWLWOH,QGLFDWHDSSRLQWHGPHPEHUVZKRDUHGHVLJQHHVIRUQDPHG SRVLWLRQV,QGLFDWHUDFHDQGJHQGHUIRUDOODSSRLQWPHQWV 8QLRQ&RXQW\)< 6SHFLILHG0HPEHUV 1DPH 7LWOH 'HVLJQHH 5DFH *HQGHU  6FKRRO6XSHULQWHQGHQWRUGHVLJQHH 'U-D\-RQHV $VVLVWDQW 6XSHULQWHQGHQWRI 6WXGHQW6XSSRUW :KLWH 0DOH  &KLHIRI3ROLFHRUGHVLJQHH 9$&$17     /RFDO6KHULIIRUGHVLJQHH &KULV%ODFN 6526HUJHDQW :KLWH 0DOH  'LVWULFW$WWRUQH\RUGHVLJQHH $VKOH\.XO\ $VVLVWDQW'$:KLWH )HPDOH  &KLHI&RXUW&RXQVHORURUGHVLJQHH 3KLOOLS6SHLJKW &KLHI&RXUW&RXQVHORU :KLWH 0DOH  'LUHFWRU/RFDO0DQDJHPHQW(QWLW\ 0DQDJHG&DUH2UJDQL]DWLRQ /0(0&2 RU GHVLJQHH 0DOLVKD5RVV 0+68&DUH 0DQDJHPHQW 6XSHUYLVRU %ODFNRU$IULFDQ $PHULFDQ )HPDOH  'LUHFWRU'66RUGHVLJQHH $OLVD(WWHU 6RFLDO:RUN3URJDP 0DQDJHU :KLWH )HPDOH  &RXQW\0DQDJHURUGHVLJQHH 3DWULFN1LODQG 'HSXW\&RXQW\ 0DQDJHU :KLWH 0DOH  6XEVWDQFH$EXVH3URIHVVLRQDO 5DFKHO3DWWRQ 6XEVWDQFH$EXVH &RXQVHORU :KLWH )HPDOH  0HPEHURI)DLWK&RPPXQLW\ -RKQ-.LUNSDWULFN ,9 5HYHUHQG %ODFNRU$IULFDQ $PHULFDQ 0DOH  &RXQW\&RPPLVVLRQHU *DU\6LGHV %RDUGRI&RXQW\ &RPPLVVLRQHU :KLWH 0DOH  $3HUVRQ8QGHUWKH$JHRI (WKDQ'DYLV <RXWK5HSUHVHQWDWLYH %ODFNRU$IULFDQ $PHULFDQ 0DOH  $3HUVRQ8QGHUWKH$JHRIRUDPHPEHU RIWKHSXEOLFUHSUHVHQWLQJWKHLQWHUHVWVRI IDPLOLHVRIDWULVNMXYHQLOHV /LOO\3DWWRQ <RXWK5HSUHVHQWDWLYH :KLWH )HPDOH  -XYHQLOH'HIHQVH$WWRUQH\ $QJHOD:DWNLQV $WWRUQH\ :KLWH )HPDOH  &KLHI'LVWULFW-XGJHRUGHVLJQHH $QQD*RRGZLQ &KLHI'LVWULFW&RXUW -XGJH :KLWH )HPDOH  0HPEHURI%XVLQHVV&RPPXQLW\ .LDOD'DYLV %XVLQHVV2ZQHU %ODFNRU$IULFDQ $PHULFDQ )HPDOH  /RFDO+HDOWK'LUHFWRURUGHVLJQHH 7UDFL&ROOH\ 8QLRQ&RXQW\3XEOLF +HDOWK'LUHFWRU :KLWH )HPDOH  5HS8QLWHG:D\RWKHUQRQSURILW 9$&$17     5HSUHVHQWDWLYH3DUNVDQG5HF -LP&KDIILQ 'LYLVLRQ'LUHFWRU :KLWH0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH $QJLH+RUQH &RXUW&RXQVHORU :KLWH )HPDOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH %RE5HLFKPDQ &RPPXQLW\0HPEHU :KLWH 0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH 'DQLHO+DLOH\ 6FKRRO5HVRXUFH 2IILFHU %ODFNRU$IULFDQ $PHULFDQ 0DOH           90 -89(1,/(&5,0(35(9(17,21&281&,/&(57,),&$7,2167$1'$5'6 Form JCPC/OP 002 (a) Juvenile Crime Prevention Council Certification Application Form structure last revised June 2024 NC Department of Public Safety 6SHFLILHG0HPEHUV 1DPH 7LWOH 'HVLJQHH 5DFH *HQGHU  &RXQW\&RPPLVVLRQHUDSSRLQWHH -DPHV-RKQVRQ-U $W/DUJH %ODFNRU$IULFDQ $PHULFDQ 0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH .ULVWRSKHU :HVWRYHU /LHXWHQDQW0RQURH 3ROLFH'HSDUWPHQW 03' :KLWH 0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH 1DWDVKD6WRYDOO &RXUW&RXQVHORU 6XSHUYLVRU %ODFNRU$IULFDQ $PHULFDQ )HPDOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH 7HUHVD+ROPHV 0HQWDO+HDOWK 3URIHVVLRQDO %ODFNRU$IULFDQ $PHULFDQ )HPDOH           91 -89(1,/(&5,0(35(9(17,21&281&,/&(57,),&$7,2167$1'$5'6 Form JCPC/OP 002 (a) Juvenile Crime Prevention Council Certification Application Form structure last revised June 2024 NC Department of Public Safety ,QVWUXFWLRQV1&*6†%VSHFLILHVVXJJHVWHGPHPEHUVEHDSSRLQWHGE\FRXQW\FRPPLVVLRQHUVWRVHUYHRQORFDO -XYHQLOH&ULPH3UHYHQWLRQ&RXQFLOV,QFHUWDLQFDWHJRULHVDGHVLJQHHPD\EHDSSRLQWHGWRVHUYH3OHDVHLQGLFDWHWKH SHUVRQDSSRLQWHGWRVHUYHLQHDFKFDWHJRU\DQGKLVKHUWLWOH,QGLFDWHDSSRLQWHGPHPEHUVZKRDUHGHVLJQHHVIRUQDPHG SRVLWLRQV,QGLFDWHUDFHDQGJHQGHUIRUDOODSSRLQWPHQWV 8QLRQ&RXQW\)< 6SHFLILHG0HPEHUV 1DPH 7LWOH 'HVLJQHH 5DFH *HQGHU  6FKRRO6XSHULQWHQGHQWRUGHVLJQHH 'U-D\-RQHV $VVLVWDQW 6XSHULQWHQGHQWRI 6WXGHQW6XSSRUW :KLWH 0DOH  &KLHIRI3ROLFHRUGHVLJQHH 9$&$17     /RFDO6KHULIIRUGHVLJQHH &KULV%ODFN 6526HUJHDQW :KLWH 0DOH  'LVWULFW$WWRUQH\RUGHVLJQHH $VKOH\.XO\ $VVLVWDQW'$:KLWH )HPDOH  &KLHI&RXUW&RXQVHORURUGHVLJQHH 3KLOOLS6SHLJKW &KLHI&RXUW&RXQVHORU :KLWH 0DOH  'LUHFWRU/RFDO0DQDJHPHQW(QWLW\ 0DQDJHG&DUH2UJDQL]DWLRQ /0(0&2 RU GHVLJQHH 0DOLVKD5RVV 0+68&DUH 0DQDJHPHQW 6XSHUYLVRU %ODFNRU$IULFDQ $PHULFDQ )HPDOH  'LUHFWRU'66RUGHVLJQHH $OLVD(WWHU 6RFLDO:RUN3URJDP 0DQDJHU :KLWH )HPDOH  &RXQW\0DQDJHURUGHVLJQHH 3DWULFN1LODQG 'HSXW\&RXQW\ 0DQDJHU :KLWH 0DOH  6XEVWDQFH$EXVH3URIHVVLRQDO 5DFKHO3DWWRQ 6XEVWDQFH$EXVH &RXQVHORU :KLWH )HPDOH  0HPEHURI)DLWK&RPPXQLW\ -RKQ-.LUNSDWULFN ,9 5HYHUHQG %ODFNRU$IULFDQ $PHULFDQ 0DOH  &RXQW\&RPPLVVLRQHU *DU\6LGHV %RDUGRI&RXQW\ &RPPLVVLRQHU :KLWH 0DOH  $3HUVRQ8QGHUWKH$JHRI (WKDQ'DYLV <RXWK5HSUHVHQWDWLYH %ODFNRU$IULFDQ $PHULFDQ 0DOH  $3HUVRQ8QGHUWKH$JHRIRUDPHPEHU RIWKHSXEOLFUHSUHVHQWLQJWKHLQWHUHVWVRI IDPLOLHVRIDWULVNMXYHQLOHV /LOO\3DWWRQ <RXWK5HSUHVHQWDWLYH :KLWH )HPDOH  -XYHQLOH'HIHQVH$WWRUQH\ $QJHOD:DWNLQV $WWRUQH\ :KLWH )HPDOH  &KLHI'LVWULFW-XGJHRUGHVLJQHH $QQD*RRGZLQ &KLHI'LVWULFW&RXUW -XGJH :KLWH )HPDOH  0HPEHURI%XVLQHVV&RPPXQLW\ .LDOD'DYLV %XVLQHVV2ZQHU %ODFNRU$IULFDQ $PHULFDQ )HPDOH  /RFDO+HDOWK'LUHFWRURUGHVLJQHH 7UDFL&ROOH\ 8QLRQ&RXQW\3XEOLF +HDOWK'LUHFWRU :KLWH )HPDOH  5HS8QLWHG:D\RWKHUQRQSURILW 9$&$17     5HSUHVHQWDWLYH3DUNVDQG5HF -LP&KDIILQ 'LYLVLRQ'LUHFWRU :KLWH0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH $QJLH+RUQH &RXUW&RXQVHORU :KLWH )HPDOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH %RE5HLFKPDQ &RPPXQLW\0HPEHU :KLWH 0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH 'DQLHO+DLOH\ 6FKRRO5HVRXUFH 2IILFHU %ODFNRU$IULFDQ $PHULFDQ 0DOH           92 -89(1,/(&5,0(35(9(17,21&281&,/&(57,),&$7,2167$1'$5'6 Form JCPC/OP 002 (a) Juvenile Crime Prevention Council Certification Application Form structure last revised June 2024 NC Department of Public Safety 6SHFLILHG0HPEHUV 1DPH 7LWOH 'HVLJQHH 5DFH *HQGHU  &RXQW\&RPPLVVLRQHUDSSRLQWHH -DPHV-RKQVRQ-U $W/DUJH %ODFNRU$IULFDQ $PHULFDQ 0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH .ULVWRSKHU :HVWRYHU /LHXWHQDQW0RQURH 3ROLFH'HSDUWPHQW 03' :KLWH 0DOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH 1DWDVKD6WRYDOO &RXUW&RXQVHORU 6XSHUYLVRU %ODFNRU$IULFDQ $PHULFDQ )HPDOH  &RXQW\&RPPLVVLRQHUDSSRLQWHH 7HUHVD+ROPHV 0HQWDO+HDOWK 3URIHVVLRQDO %ODFNRU$IULFDQ $PHULFDQ )HPDOH           93 SUMMARY REPORT OF THE RISK AND NEEDS ASSESSMENT COMMITTEE I. Youth Assessment and Screening Instrument (YASI) Summary II. Summary of Community Resources III. Summary of Gaps and Barriers in the Community Continuum IV. Proposed Priority Services for Funding Introduction: Juvenile Court Services implemented the Youth Assessment and Screening Instrument (YASI) beginning January 1, 2021; the following data summary represents the first full fiscal year of implementation of the YASI. In reviewing and prioritizing the elevated risk and needs extracted from this data set, one must consider the utilization of YASI: 1. As a predictor of future risk of offending; and 2. As a Case Management instrument for determining level of service and types of services necessary to reduce recidivism. Part I. Youth Assessment and Screening Instrument (Full YASI) The Risk and Needs Assessment Committee reviewed aggregate data gleaned from YASI assessments administered in the county during the previous fiscal year. The full assessment consists of over 100 separate items useful for both predictive risk and case management, so data reported from this review will consist of county-level risk factors that may be prioritized by the JCPC for RFP development, as well as for highlighting prevalent issues among court involved juveniles that individual programs and community-based service organizations will want to consider when working with court- involved juveniles in the county. All juveniles at intake receive the YASI Pre-Screen (33 questions) which is also embedded in each full assessment. The aggregate outputs from full YASI assessments are just one of the data sources used by the Committee and, are the focus of summaries that follow in this document. YASI questions are framed in either a historic context (Legal History, for example), or in some cases, “current” or “prior three-months” timeframes for other, more dynamic, questions.           94 Elevated Risk and Needs: The Risk and Nees Committee met to review the YASI Data. The YASI Data includes the review of 291 juveniles for fiscal year 2024-2025. Union County YASI Data reported that 64% was Low Risk, 25% was Moderate Risk, and 11% was High Risk. Elevated factors relevant for Juvenile Justice program development in the county: SUMMARY COMMENTS: YASI assessment points of interest for Union County: Legal History Domain x Age at First Referral (Under 12): Union County 11% - State 9% Family History Domain x Living with Parent/Stepparent: Union County 84% - State 84% x Living with Sibling, Relative, Other: Union County 73% - State 74% x *Foster Care, Independent, Other: Union County 8% - State 9% x Good/Some Supervision: Union COunty 93% - State 81% School Domain x Suspended: Union County 6% - State 3% x Attends Regularly: Union County 79% - State 57% x Not Applicable: Union County 9% - State 9% x Police Filed by School: Union County 49% - State 22% x One or More OSS: Union County 63% - State 61% x Interested in Two+ Activities: Union County 10% - State 9% x Involved in One Activity: Union County 14% - State 14% x Interested but Not Involved in School Activities: Union County 38% - State 31% Community & Peers Domain x No Friends/No Consistent Friends: Union County 22% - State 15%           95 x *Leads Anti-Social Peers: Union County 1% - State 2% Alcohol/Drugs x *Reported Alcohol/Drug Use: Union County 39% - State 40% x Age Reported at First Use Under 12: Union County 17% - State 11% x Age Reported at First Use 15+: Union County 12% - State 10% x Previous Drug Treatment: Union County 58% - State 58% Mental Health x Current Medications: Union County 20% - State 18% x Sexual Abuse History: Union County 6% - State 6% x Victim of Bullying: Union County 15% - State 11% x Physical Assault: Union County 14% - State 9% Physical Health x No elevated risk factors. Aggression x No elevated risk factors; monitoring aggression categories. Employment & Free Time x Never Employed: Union County 82% - State 78% x One or More Unstructured Free Time: Union County 30% - State 26%           96 Part II. Summary of Community Resources The following is a list of existing resources. It is not a measure of resource effectiveness and/or sustainability: JCPC Funded Programs 2026-2027 Life Connections of the Carolinas-DASH Counseling Services Transforming Youth Movement, INC- Transforming Futures Aspire Youth & Family, Inc-Kids At Work! Union Union County-JCPC Administration A.R.I.S.E- Union-Kre8ivu The Connect Center Transforming Youth Movement-Union County Teen Court Program NCCDC Next Step Youth Program           97 ADD CONTINUUM OF SERVICES – AT A GLANCE         98 Part III. Summary of Gaps and Barriers in the Continuum of Services x Transportation: Transportation barriers for juvenile participating in programs. x Referrals: Lack of program initiative to seek referrals outside of referrals from DJJ. x Funding: Need for additional funding in county to potentially fund more programs. x Space: Challenges with securing facilities or space to host current or additional sessions. x Awareness: Lack of program initiative to seek community awareness of program and services. Part IV. Proposed Priority Services for Funding The Committee proposes that the following services in ranked order be approved as the funding priorities for FY 26-27: x Clinical or Psychological Evaluations x Substance Abuse Treatment x Teen Court x Parent/Family Skill Building x Mentoring x Tutoring/Academic Enhancement Programs x Restitution/Community Service x Vocational Development x Experiential Skill Building x Interpersonal Skill Building x Mediation/Conflict Resolution x Juvenile Structured Day x Home Based Counseling x Individual/Family/Group Counseling x Problem Sexual Behavior x Assessment/Treatment x Temporary Shelter Care x Runway Shelter Care           99 YASI Full Assessment Data 291Assessed JuvenilesUnion CountyRisk LevelUnion StateNeeds LevelUnion StateLow 64% 44% Very Low 20% 19%Moderate 25% 41% Low 61% 36%High 11% 15% Moderate 12% 22%High Moderate 5% 14%High 1% 5%Very High 1% 3%Strengths Level Union StateVery Low 0% 1%Low 2% 4%Moderate 6% 13%High Moderate 16% 24%High 20% 23%Very High 56% 35%RISK/NEEDS/STRENGTHS LEVEL0%20%40%60%80%100%Low Moderate HighRisk LevelUnionState0%10%20%30%40%50%60%70%80%90%100%Very Low Low Moderate HighModerateHigh Very HighNeeds LevelUnionState0%20%40%60%80%100%Very Low Low Moderate HighModerateHigh Very HighStrengths LevelUnionState         100 Q1 Previous Delinquent ReferralsUnion State Q3 Number of Referrals w ResultUnion StatePrevious Referrals 41% 46% Referrals with a Result 49% 63%Q2 Age at First ReferralUnion StateQ4 Felony Referrals to DJJUnion StateUnder 12 11% 9% Juveniles with Felony Referrals 25% 35%LEGAL HISTORY0%20%40%60%80%100%Union StatePrevious Referrals0%10%20%30%40%50%60%70%80%90%100%Union StateUnder 120%20%40%60%80%100%Union StateReferrals with a Result0%10%20%30%40%50%60%70%80%90%100%Union StateJuveniles with Felony Referrals11%         101 Q6 Weapon Offenses - 1 or moreUnion StateQ10 Detention AdmissionsUnion StatePrevious Weapon Offense - Yes 13% 18% Prior Detention Admission Histx 12% 20%Q7 Person CrimesUnion StateQ11 YDC PlacementUnion StateReferrals for Person Crimes 31% 41% Prior YDC Custody 1% 3% 0%20%40%60%80%100%Union StatePrevious Weapon Offense - Yes0%20%40%60%80%100%Union StatePrior Detention Admission Histx0%20%40%60%80%100%Union StateReferrals for Person Crimes0%20%40%60%80%100%Union StatePrior YDC Custody         102 Q1 Kicked OutUnion StateQ1 RunawayUnion StateKicked Out 3% 6% Runaway 15% 21%Q4 Family Alcohol/SA & MHUnion StateQ4 Family Criminal HistoryUnion StateFamily Member Alcohol/SA 6% 12% Family Member prior Criminal Hst 15% 24%Family Member MH 9% 12% Family Member prior Violent Hst 1% 6%FAMILY0%20%40%60%80%100%Union StateKicked Out0%20%40%60%80%100%Union StateRunaway0%20%40%60%80%100%Family Member Alcohol/SA Family Member MHFamily Alcohol/SA & MHUnionState0%20%40%60%80%100%Family Member prior Criminal Hst Family Member prior Violent HstFamily Criminal HistoryUnionState         103 Q6 Living ArrangementsUnion StateQ7 Parent/Custodian SupervisionUnion StateLiving w Parent/StepParent 84% 84% Good/some Supvs 93% 81%Living w Sibling, Relative, Other 73% 74% Some/frequent Inadequate Supvs 4% 16%Foster Care, Independent, Other 8% 9% Consistently Inadequate Supvs 0% 2%Q1 School Enrollment StatusUnion StateQ2 Attendance - past 3 mos.Union StateDropped Out 3% 5% Attends regularly 79% 57%Suspended 6% 3% 5 or more Unexcused Absences 4% 19%Not Applicable 0% 3% Not Applicable 9% 9%SCHOOL0%10%20%30%40%50%60%70%80%90%100%Living w Parent/StepParent Living w Sibling, Relative,OtherFoster Care, Independent,OtherLiving ArrangementsUnionState0%10%20%30%40%50%60%70%80%90%100%Good/some Supvs Some/frequent InadequateSupvsConsistently InadequateSupvsParent/Custodian SupervisionUnionState0%20%40%60%80%100%Dropped Out Suspended Not ApplicableSchool Enrollment UnionState0%20%40%60%80%100%Attends regularly 5 or more UnexcusedAbsencesNot ApplicableAttendance - past 3 mos.UnionState9%79%93%84%8%73%         104 Q3 School Conflict - past 3 mos.Union StateQ4 Academics - past 3 mos.Union StateInfraction(s) 12% 16% C- or Lower 12% 14%Intervention - School Administrator12% 16% Failing Some Classes 9% 15%Police Reports Filed by School 49% 22% Failing Most Classes 7% 14%Not Applicable 10% 12% Not Applicable 7% 11%Q10 School Behavior - past 2 yrs.Union StateQ12 School Activities - past 3 mos.Union StateOne or more OSS 63% 61% Involved in two+ activities 10% 9%One or more ISS 27% 42% Involved in one activity 14% 14%Interested but not involved 38% 31%No interest in school activities 23% 28%0%20%40%60%80%100%Infraction(s) Intervention - SchoolAdministratorPolice Reports Filedby SchoolNot ApplicableSchool Conflict - past 3 mos.UnionState0%20%40%60%80%100%C- or Lower Failing Some Classes Failing Most Classes Not ApplicableAcademics - past 3 mos.UnionState0%20%40%60%80%100%Union StateSchool Behavior - past 2 yrs.One or more OSSOne or more ISS0%20%40%60%80%100%Involved in oneactivityInterested but notinvolvedNo interest in schoolactivitiesSchool Activities - most recent school yearUnionState38%14%10%63%49%         105 Q1 Peers/AssociatesUnion StateQ6 Negative Peer AssociationsUnion StateNo friends/No Consistent Friends 22% 15% Sometimes goes along with 11% 32%Negative/Delinquent Influence 23% 46% Usually goes along with 6% 13%Associates with Gang Members 2% 6% Leads Anti-Social Peers 1% 2%Family has Gang Members 0% 1%Youth is a Gang Member 0% 1%% Reporting Alcohol/Drug UseUnion StateQ1 Age at 1st UseUnion StateYes to Alcohol/Drug Use 39% 40% Under 12 17% 11%Ages 12-15 71% 78%Age 15+ 12% 10%ALCOHOL/DRUGS - Q1-Q3 dividing by Juveniles with "Yes" to Alcohol/DrugsCOMMUNITY & PEERS0%10%20%30%40%50%60%70%80%90%100%Peers/AssociatesUnionState0%10%20%30%40%50%60%70%80%90%100%Sometimes goes along with Usually goes along with Leads Anti-Social PeersInfluence of Negative PeersUnionState0%10%20%30%40%50%60%70%80%90%100%Union StateYes to Alcohol/Drug Use0%10%20%30%40%50%60%70%80%90%Under 12 Ages 12-15 Age 15+Age at First UseUnionState1%12%17%39%22%         106 Q1 Alcohol/Drug UseUnion StateQ3 Previous Alcohol/Drug TreatxUnion StateUse Disrupts Function 19% 29% No 58% 58%Yes 1% 8%Juvenile-Mental Health ProblemsUnion StateQ1 Current/Past Treatx-MedsUnion StateJuveniles - Yes to MH Problems 29% 38% Current Treatx 19% 21%Juveniles - Diagnosed 29% 38% Past Treatx 10% 18%Current Meds 20% 18%Past Meds 9% 15%MENTAL HEALTH0%10%20%30%40%50%60%70%80%90%100%Union StateUse Disrupts Function0%10%20%30%40%50%60%70%No YesPrevious Drug TreatmentUnionState0%10%20%30%40%50%60%70%80%90%100%Juveniles - Yes to MH Problems Juveniles - DiagnosedJuvenile Mental HealthUnionState0%20%40%60%80%100%Current Treatx Past Treatx Current Meds Past MedsCurrent/Past Treatment & MedicationsUnionState20%58%         107 Q5 History of AbuseUnion StateQ6 Victimization HistoryUnion StatePhysical Abuse Histx 4% 8% Sexual Vulnerability 3% 6%Sexual Abuse Histx 6% 6% Victim of Bullying 15% 11%Physical Assault 14% 9%Q2 Health InsuranceUnion StateNo Health Insurance 8% 10%PHYSICAL HEALTH0%10%20%30%40%50%60%70%80%90%100%Physical Abuse Histx Sexual Abuse HistxHistory of AbuseUnionState0%10%20%30%40%50%60%70%80%90%100%Sexual Vulnerability Victim of Bullying Physical AssaultVictimizationUnionState0%10%20%30%40%50%60%70%80%90%100%Union StateNo Health Insurance6%14%15%         108 Q1 ViolenceUnion StateQ1 ViolenceUnion StateDisplayed a Weapon 7% 11% Bullying/Threatening 13% 22%Used a Weapon 6% 8% Destruction of Property 6% 12%Assaultive Behavior 32% 39%AISI-Assault w Serious Injury 2% 4%Q1 Employment HistoryUnion StateQ5 & Q6 Free TimeUnion StateCurrently employed 14% 17% Yes - One or More Structured 19% 22%Never employed 82% 78% Yes - One or More Unstructured 30% 26%Prior successful employment 6% 9%AGGRESSIONEMPLOYMENT & FREE TIME0%10%20%30%40%50%60%70%80%90%100%Displayed a Weapon Used a WeaponViolenceUnionState0%10%20%30%40%50%60%70%80%90%100%Bullying/Threatening Destruction ofPropertyAssaultive Behavior AISI-Assault w SeriousInjuryViolenceUnionState0%5%10%15%20%25%30%35%Yes - One or More Structured Yes - One or More UnstructuredFree TimeUnionState0%10%20%30%40%50%60%70%80%90%Currently employed Never employed Prior successful employmentEmploymentUnionState30%82%         109           110           111           112           113 The Juvenile Crime Prevention Council (JCPC) has studied the risk factors and needs of Juvenile Court involved youth in this county and hereby publishes this Request for Proposals. The JCPC anticipates funds from the NC Dept. of Public Safety Juvenile Justice and Delinquency Prevention in the amount stated above to fund the program types specified below. Such programs will serve delinquent and at-risk youth for the state fiscal year 2025-2026 beginning on, or after, July 1, 2025. The use of these funds in this county require a local match in the amount specified above. The county can approve programs for 1 year funding awards, dependent on county approval and programs meeting all requirements. Based on identified needed programs and possible gaps in the service continuum, the following program types will be considered for funding: Clinical or Psychological Evaluations Substance Abuse Treatment Teen Court Parent/Family Skill Building Mentoring Tutoring/Academic Enhancement Programs Restitution/Community Service Vocational Development Experiential Skill Building Interpersonal Skill Building Mediation/Conflict Resolution Juvenile Structured Day Home Based Counseling Individual/Family/Group Counseling Problem Sexual Behavior Assessment/Treatment Temporary Shelter Care Runway Shelter Care Proposed program services should target the following risk factors for delinquency or repeat delinquency: *School Problem Behaviors *Juveniles who associate with other delinquent peers *Substance abuse *Parenting Skills *Mental Health *Reduction in juvenile recidivism *Gang involvement * Weapon possession Proposed services should address the following concerns as reported in the Youth Assessment Screening Instrument (YASI) for adjudicated youth: Peer Domain: Union County Youth have no friends/ no consistent friends. Individual Domain: Youth have felony referrals, have first referral under the age of 12, prior detention history, alcohol/ drug use and history of physical assault, have displayed a weapon. Family Domain: Youth involved with the juvenile justice system have run away from home or been kicked out, living with sibling other than a parent, youth who have a family member that is involved with a gang. School Domain: Union County Youth have dropped out, failing some classes, out of school suspension, negative school behavior, not involved in structured activities. Applicants are being sought that are able to address items below: 1. Program services compatible with research that are shown to be effective with juvenile offenders. 2. Program services are outcome-based. 3. The program has an evaluation component. 4. Program services detect gang participation and divert individuals from gang participation. 5. Awareness of and sensitivity to Racial Ethnic Disparity that exists in the County. 6. Programs are encouraged to provide effective programming that includes restorative justice practices. Only local public agencies, 501c3 non-profit corporations and local housing authorities will be considered for funding. In order to apply for FY 2025-2026 JCPC funding, you must complete and submit your application online by accessing NC ALLIES. Please read and follow all instructions at: https://cp.ncdjjdp.org/CP Additional self-help videos on the NC ALLIES webpage are available by clicking on the HELP tab. Private non-profits are also required to submit, by uploading in NC ALLIES, the following: 1) No Over Due Tax form, 2) DPS Conflict of Interest Statement, 3) Agency Conflict of Interest Policy, and 4) Proof of 501(c)(3) status. (#1 & #2 are available at the above link.) John Kirkpatrick (910) 334-6863 JCPC Chairperson / or Designee Telephone # For further information or other technical assistance about applying for JCPC funds in this county contact: Sherri Hill , DPS Area Consultant at 704-754-8218. The deadline for receiving the application: February 10, 2025 5:00pm Union County Juvenile Crime Prevention Council Request for Proposals 476,439 30% January 10, 2025 Anticipated Annual Allocation Required Local Match Rate Date Advertised           114 Juvenile Crime Prevention Council Funding Decisions SummaryNovember 2, 2020Funding Decision for:FY 26-27 Date Completed:Program(s) FundedSelect 1-year or 2-year funding and reason(s) for Funding (Check all that apply)2-year Funding approved for FY and OR 1-yearFunding approved for FY Rationale for 2-year Fundingapproval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70%(min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population),with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victimsAddresses gang participationWould increase funding to this service if funds were available Other Other 2-year Funding approved for FY and OR 1-year Funding approved for FY Rationale for 2-year Fundingapproval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70% (min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population), with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victims Addresses gang participationWould increase funding to this service if funds were available Other Other 2-year Funding approved for FY and OR 1-year Funding approved for FY Rationale for 2-year Fundingapproval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70% (min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population), with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victims Addresses gang participationWould increase funding to this service if funds were available Other Other 2-year Funding approved for FY and OR 1-year Funding approved for FY Rationale for 2-year Fundingapproval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70% (min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population), with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victims Addresses gang participationWould increase funding to this service if funds were available Other Other ng andand ddiLife Connections of the Carolinas - DASHTransforming Youth Movement, INC- Transforming FuturesTransforming Youth Movement-Union County TeenCourt Program Aspire Youth & Family, Inc-Kids At Work! Union         115 Juvenile Crime Prevention Council Funding Decisions Summary November 2, 2020 2-year Funding approved for FY and OR 1-year Funding approved for FY Rationale for 2-year Funding approval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70% (min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population), with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victims Addresses gang participation Would increase funding to this service if funds were available Other Other 2-year Funding approved for FY and OR 1-year Funding approved for FY Rationale for 2-year Funding approval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70% (min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population), with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victims Addresses gang participation Would increase funding to this service if funds were available Other Other 2-year Funding approved for FY and OR 1-year Funding approved for FY Rationale for 2-year Funding approval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70% (min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population), with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victims Addresses gang participation Would increase funding to this service if funds were available Other Other 2-year Funding approved for FY and OR 1-year Funding approved for FY Rationale for 2-year Funding approval: Funded in past years In good standing with county/JCPC and DPS (following PA, timely reports, reporting to JCPC as requested) Favorable JCPC monitoring In compliance with Consultant Monitoring Quality of Service Assessment (QOS) rating is min 70% (min. score of 14) OR progress made on PEP in QOS. Provides an essential dispositional option, explain: Meets target population as described in Program Agreement (number served, and described target population), with minimal exceptions (i.e. less than 10% variance) Meets funding priority Compatible with research Cost efficient Addresses reductions of complaints, violations of supervision & convictions Has evaluation component Addresses parental accountability Addresses use of alcohol/controlled substances Addresses restitution to victims Addresses gang participation Would increase funding to this service if funds were available Other Other A.R.I.S.E- Union-Kre8ivu The Connect Center NCCDC Next Step Youth ProgramUnion County JCPC Administration         116 Juvenile Crime Prevention Council Funding Decisions Summary November 2, 2020 Program Not Funded Reason for Not Funding (Check all that apply) Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other Lack of funding, addresses priority need and would fund if resources allowed Does not meet funding priority Not compatible with research Lesser quality than another program funded of its type Greater cost than program of same type and quality Other Other CA based organization; No UC connectionDid not meet RFP upload requirementsYouth Advocate Mentorship (YAM)- Growing with TrustStudentNest Academic Bridge Program         117 +g]Og<Z [P<[EIZI[j +Y<[ ¥++¦+g]Og<Z› ]Zd][I[jQGh<j7]gX‰ gQINIhEgQdjQ][QGhj7]gXQh<[Q[jIgdIgh][<YhXQYYhGIpIY]dZI[jdg]Og<ZD<hIG<g]k[GjPIEkYQ[<gs<gjh9]kjP<gI<d<gj]NjPIdg]Og<ZN]gÂÇqIIXh<[GZIIjN]gjPgIIP]kgh][EI<qIIXN]gQ[hjgkEjQ][0PIEkggQEkYkZE][hQhjh]NÃÅP<[GhŸ][YIhh][hjP<j<gIGIhQO[IGj]ZIIjjPIEYQI[jhk[QfkIYI<g[Q[OhjsYIh<[GPIYdjPIZ<ddYsjPIhXQYYhQ[<q]gXI[pQg][ZI[j9]kjP<OIhÂÆÛ<Yh]gIEIQpIjg<Q[Q[OQ[N]]Gh<NIjspQ</Igp/<NIQ[]gGIgj]O<Q[EIgjQNQE<jQ][<[G<[IGOIQ[IZdY]sZI[j <jIO]gs/++/E]gI[P<[EIZI[j$dd]gjk[Qjs EjQ][/jIdh .Ihd][hQDYI+<gjs+g]OgIhh.Id]gjIhEgQDIdg]OgIhhZ<GIQ[EYkGIG<jIqP<jP<hDII[E]ZdYIjIGQ[dg]EIhh]g[]dg]OgIhh+gQZ<gs/IgpQEIÂÆ-k<YQNsQ[O/kddYIZI[j<Y/IgpQEIÆ-k<YQjs]N/IgpQEIIYQpIgsÂÊ/j<NNp<Yk<jQ][7gQjI</j<NNp<Yk<jQ][<[GIpIY]dZI[j+Y<[ŽÐ.IpQhIjPIIp<Yk<jQ][N]gZhN]g<YYhj<NNd]hQjQ][hŽĐhhQO[hkdIgpQh]ghj]E]ZdYIjII<EPhj<NNIp<Yk<jQ][hŽŐ/EPIGkYI<YYhj<NNIp<Yk<jQ][hj]]EEkgDsÂ›ÂÆ›Ãǎǐ ]ZdYIjIIp<Yk<jQ][hqQjPhj<NNŽȐ7gQjI</j<NNIpIY]dZI[j+Y<[Q[E]gd]g<jQ[O<gI<hN]gQZdg]pIZI[j›GIpIY]dZI[jN]gI<EPhj<NNŽɐhj<DYQhP<N]YY]qkddg]EIGkgI][hIjO]<Yh›<gI<hN]gQZdg]pIZI[jQhjgQEj I<GIg+g]Og<Z!<[<OIg!<[<OIZI[jjI<ZZIjj]GQhEkhhhj<NNIp<Yk<jQ][IYIZI[jh<[Gj<gOIjIG<gI<hN]gQZdg]pIZI[jYYhj<NNIp<Yk<jQ][hP<pIDII[<hhQO[IGj]jPI<ddg]dgQ<jIZ<[<OIgZ]k[j]N/IgpQEIkg<jQ][<[G ][j<Ej]kghÂÃ.QhX IpIY]N9]kjPÂÄ0]j<Y/++/E]gIÇÅ+$+ÈÆÚ0PQh+Y<[Qh<ddg]pIGDsZěķðüŢİɖ ÕŨůÕĸȆ ϞϝϿϞϤϿϟϢ+g]Og<Z!<[<OIg/QO[<jkgI <jI  +  P<Qg/QO[<jkgI <jI         118 Form JCPC/PA 004 JCPC Program Application Form structure last revised 12/31/2012 Department of Public Safety 6(&7,21,%352*5$0&20321(17'(6&5,37,21 &20321(17,' &20321(17,1)250$7,21 46952 1$0(2)&20321(17&OLQLFDO$VVHVVPHQWVDQG7UHDWPHQW %5,()'(6&5,37,21,QSDUWQHUVKLSZLWK+HDOLQJ3DWKZD\V)RXQGDWLRQV'$6+&RXQVHOLQJ 6HUYLFHVVXSSRUWV8QLRQ&RXQW\¶VDWULVN\RXWKE\DGGUHVVLQJWKHLPSDFWRI$GYHUVH&KLOGKRRG ([SHULHQFHV7KURXJKVSHFLDOL]HGFOLQLFDODVVHVVPHQWVDQGWUDXPDLQIRUPHGFDUHZHLGHQWLI\ PHQWDOKHDOWKDQGVXEVWDQFHXVHQHHGVWRKHOSUHGXFHUHFLGLYLVPDQGEXLOGKHDOWKLHUPRUH UHVLOLHQWOLYHV &20321(17,' &20321(17,1)250$7,21 46953 1$0(2)&20321(17'$6+6XEVWDQFH$EXVH6HUYLFHV %5,()'(6&5,37,21,QSDUWQHUVKLSZLWK+HDOLQJ3DWKZD\V)RXQGDWLRQV'$6+&RXQVHOLQJ 6HUYLFHVVXSSRUWV8QLRQ&RXQW\¶VDWULVN\RXWKE\DGGUHVVLQJWKHLPSDFWRI$GYHUVH&KLOGKRRG ([SHULHQFHV7KURXJKVSHFLDOL]HGFOLQLFDODVVHVVPHQWVDQGWUDXPDLQIRUPHGFDUHZHLGHQWLI\ PHQWDOKHDOWKDQGVXEVWDQFHXVHQHHGVWRKHOSUHGXFHUHFLGLYLVPDQGEXLOGKHDOWKLHUPRUH UHVLOLHQWOLYHV &20321(17,' &20321(17,1)250$7,21 46955 1$0(2)&20321(17&RPSUHKHQVLYH0HQWDO+HDOWK&RXQVHOLQJ6HUYLFHV %5,()'(6&5,37,21,QSDUWQHUVKLSZLWK+HDOLQJ3DWKZD\V)RXQGDWLRQV'$6+&RXQVHOLQJ 6HUYLFHVVXSSRUWV8QLRQ&RXQW\¶VDWULVN\RXWKE\DGGUHVVLQJWKHLPSDFWRI$GYHUVH&KLOGKRRG ([SHULHQFHV7KURXJKVSHFLDOL]HGFOLQLFDODVVHVVPHQWVDQGWUDXPDLQIRUPHGFDUHZHLGHQWLI\ PHQWDOKHDOWKDQGVXEVWDQFHXVHQHHGVWRKHOSUHGXFHUHFLGLYLVPDQGEXLOGKHDOWKLHUPRUH UHVLOLHQWOLYHV           119 Form JCPC/PA 004 JCPC Program Application Form structure last revised 12/31/2012 Department of Public Safety 6(&7,21,%352*5$0&20321(17'(6&5,37,21 &20321(17,' &20321(17,1)250$7,21 46674 1$0(2)&20321(177UDQVIRUPLQJ)XWXUHV&RPPXQLW\6HUYLFH %5,()'(6&5,37,217UDQVIRUPLQJ)XWXUHV&RPPXQLW\6HUYLFHSURYLGHVMXVWLFHLQYROYHG \RXWKDJHVZLWKVWUXFWXUHGLQWHUHVWEDVHGRSSRUWXQLWLHVWKDWSURPRWHDFFRXQWDELOLW\DQG VNLOOGHYHORSPHQW3DUWLFLSDQWVHDUQPRQH\WRZDUGYLFWLPUHVWLWXWLRQZKLOHHQJDJLQJLQ PHDQLQJIXOVHUYLFHSURMHFWV*URXQGHGLQDWUDXPDLQIRUPHGDSSURDFKWKHSURJUDPIRVWHUV UHVSRQVLELOLW\UHGXFHVUHFLGLYLVPDQGKHOSV\RXWKEXLOGSRVLWLYHFRQQHFWLRQVZLWKLQWKHLU FRPPXQLWLHV &20321(17,' &20321(17,1)250$7,21 46675 1$0(2)&20321(177UDQVIRUPLQJ)XWXUHV&DUHHU([SORUDWLRQ %5,()'(6&5,37,217UDQVIRUPLQJ)XWXUHV&DUHHU([SORUDWLRQHPSRZHUVMXVWLFHLQYROYHG \RXWKDJHVZLWKWKHVNLOOVDQGH[SHULHQFHVQHHGHGIRUVXFFHVVWKURXJKLPPHUVLYH ([WHQGHG5HDOLW\&DUHHU6LPXODWLRQV7UDLQLQJVKDQGVRQOHDUQLQJDQGVRIWVNLOOVGHYHORSPHQW 7KHSDUWLFLSDQWVH[SORUHFDUHHUSDWKZD\VLQDUHDOZRUOGFRQWH[W7KHSURJUDPFXOPLQDWHVZLWK DEXVLQHVVSLWFKFRPSHWLWLRQDQGDJUDGXDWLRQZKHUH\RXWKHDUQDVWLSHQGIRUVXFFHVVIXOO\ FRPSOHWLQJWKHKRXUSURJUDP           120 Form JCPC/PA 001 JCPC Program Agreement Form structure last revised 12/31/2012 Department of Public Safety 6(&7,21,%352*5$0&20321(17'(6&5,37,21 &20321(17,' &20321(17,1)250$7,21 46676 1$0(2)&20321(178QLRQ&RXQW\7HHQ&RXUW3URJUDP %5,()'(6&5,37,218QLRQ&RXQW\7HHQ&RXUWLVDUHVWRUDWLYHMXVWLFHSURJUDPWKDWGLYHUWV \RXWKIURPIRUPDOFRXUWSURFHHGLQJV3DUWLFLSDQWVWDNHDFFRXQWDELOLW\WKURXJKSHHUMXU\KHDULQJV DQGFRPSOHWHFRQVWUXFWLYHVDQFWLRQVWKDWSURPRWHSHUVRQDOUHVSRQVLELOLW\7KLVSURFHVV SURYLGHVDVHFRQGFKDQFHZKLOHUHLQIRUFLQJSRVLWLYHGHFLVLRQPDNLQJDQGFRPPXQLW\ HQJDJHPHQW           121 Form JCPC/PA 004 JCPC Program Application Form structure last revised 12/31/2012 Department of Public Safety 6(&7,21,%352*5$0&20321(17'(6&5,37,21 &20321(17,' &20321(17,1)250$7,21 46857 1$0(2)&20321(17.LGV$W:RUN %5,()'(6&5,37,21.LGV$W:RUNLVDQLQWHUSHUVRQDOVNLOOVGHYHORSPHQWSURJUDPEDVHG DURXQGWKHFXOLQDU\DUWV<RXWKDUHDSDUWRIWKHSURJUDPIRUZHHNVDQGPHHWIRUWKUHHKRXUV RQFHDZHHNIRULQVWUXFWLRQ7KHFXUULFXOXPFRQVLVWVRIKDQGVRQOHVVRQVWKDWDUHGHVLJQHG WRPHHWWKHFOLHQWVXQLTXHOHDUQLQJVW\OHVDQGKHOSWKHPDSSO\WKHVNLOOVLQDZRUNHQYLURQPHQW <RXWKDJHVUHFHLYH6HUY6DIHIRRGVDIHW\WUDLQLQJDQGFHUWLILFDWLRQH[DPPDNLQJWKHP PRUHPDUNHWDEOHIRUHPSOR\PHQW           122 Form JCPC/PA 004 JCPC Program Application Form structure last revised 12/31/2012 Department of Public Safety 6(&7,21,%352*5$0&20321(17'(6&5,37,21 &20321(17,' &20321(17,1)250$7,21 46654 1$0(2)&20321(17$5,6( %5,()'(6&5,37,21$5,6( $UWV5HODWHG,QQRYDWLYH6WXGHQW(PSRZHUPHQW SURYLGHVDW ULVN\RXWKZLWKFUHDWLYHRXWOHWVDQGFDUHHUWUDLQLQJRSSRUWXQLWLHVWKURXJKLWV&LQHPDWRJUDSK\ DQG0XVLF$XGLR3URGXFWLRQSURJUDPV$WULVN\RXWKUDQJLQJLQDJHV\UVZLOOFUHDWHDQG GHYHORSVNLOOVEXLOGLQJFRQILGHQFHDQGWHDPZRUNLQPXVLFFRPSRVLWLRQVRXQGGHVLJQDQG DXGLRHGLWLQJWKURXJKSURMHFWV7KHSURJUDPRIIHUVRSWLPLVPE\LQVWLOOLQJDVHQVHRISXUSRVH HQWUHSUHQHXUVKLSDQGQHZSRVVLELOLWLHVIRUWKHIXWXUH           123 Form JCPC/PA 004 JCPC Program Application Form structure last revised 12/31/2012 Department of Public Safety 6(&7,21,%352*5$0&20321(17'(6&5,37,21 &20321(17,' &20321(17,1)250$7,21 47027 1$0(2)&20321(177KH&RQQHFW6FKRODUV %5,()'(6&5,37,217KH&RQQHFW6FKRODUV3URJUDPLVDFRPSUHKHQVLYHQRQSURILWSURJUDP GHVLJQHGWRHGXFDWHDQGEULGJHWKHJDSIRUDWULVNVWXGHQWV$LPVWRIRVWHUDQGPHQWRU DFDGHPLFVXFFHVVDQGFDUHHUUHDGLQHVVE\SURYLGLQJFRPSUHKHQVLYHVXSSRUWVHUYLFHV DZDUHQHVVSUHYHQWLRQDQGLQWHUYHQWLRQ IRUPLGGOHDQGKLJKVFKRROVWXGHQWV DJHV  7KH&RQQHFW6FKRODU¶VSURJUDPSULRULWL]HVILUVWJHQHUDWLRQFROOHJHERXQGVWXGHQWVDQGWKRVH ZKRODFNDFFHVVWRFULWLFDOUHVRXUFHVGXHWRV\VWHPLFLQHTXLWLHV           124 Form JCPC/PA 004 JCPC Program Application Form structure last revised 12/31/2012 Department of Public Safety 6(&7,21,%352*5$0&20321(17'(6&5,37,21 &20321(17,' &20321(17,1)250$7,21 47528 1$0(2)&20321(171H[W6WHS<RXWK3URJUDP %5,()'(6&5,37,213URYLGLQJLQGLYLGXDOL]HGDQGVPDOOJURXSDFDGHPLFLQVWUXFWLRQWR DGGUHVVOHDUQLQJJDSVDQGUHLQIRUFHFODVVURRPVWDQGDUGV'HOLYHUWXWRULQJDQGHQULFKPHQW DFWLYLWLHVWKDWVXSSRUWOLWHUDF\PDWKDQGFULWLFDOWKLQNLQJVNLOOVKHOSLQJVWXGHQWVLPSURYH DFDGHPLFSHUIRUPDQFHDQGFRQILGHQFHIRUWZRKRXUVDZHHN &20321(17,' &20321(17,1)250$7,21 47565 1$0(2)&20321(171H[W6WHS<RXWK3URJUDP %5,()'(6&5,37,217KH*URXS6HVVLRQ&RPSRQHQWZLOOEHIDFLOLWDWHGE\JUDGXDWHOHYHO LQWHUQVIURP:LQJDWH8QLYHUVLW\¶V0DVWHURI6RFLDO:RUN 06: SURJUDP7KHVHVWUXFWXUHG VHVVLRQVDUHGHVLJQHGWRVXSSRUWVWXGHQWV¶VRFLDOHPRWLRQDOGHYHORSPHQWZHOOQHVVDQG LQWHUSHUVRQDOVNLOOVLQDVDIHDQGVXSSRUWLYHHQYLURQPHQW*URXSVHVVLRQVPD\LQFOXGHWRSLFV VXFKDV(PRWLRQDOUHJXODWLRQDQGVHOIDZDUHQHVV&RQIOLFWUHVROXWLRQDQGSHHUUHODWLRQVKLSV 6WUHVVPDQDJHPHQWDQGFRSLQJVWUDWHJLHVDQGFRQILGHQFHEXLOGLQJ           125 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-329 Agenda Date:6/16/2026 TITLE:..title 2026 Union County Jail Bond Referendum Introduction of Bond Orders and Call for Public Hearing INFORMATION CONTACT: Beverly Liles, Finance, Director, 704-283-3675 ACTION REQUESTED: 1) Introduce Bond Order Authorizing the Issuance $200,000,000 General Obligation Jail Bonds of the County of Union, North Carolina, 2) Adopt Resolution of the County of Union, North Carolina Regarding Bond Order Authorizing the Issuance of General Obligation Jail Bonds, Setting Public Hearing Thereon and Directing Publication of Notice of Said Public Hearing. PRIOR BOARD ACTIONS: 1) May 18, 2026, Regular Meeting, Agenda Item #26-266 - The Board adopted Resolution of the Board of Commissioners of the County of Union, North Carolina directing the Publication of Notice of Intention to apply to the Local Government Commission for approval of $200,000,000 General Obligation Jail Bonds and adopted resolution making Certain statements of facts concerning the proposed jail bond issue and authorizing the application to the Local Government Commission for $200,000,000 of general obligation jail bonds. 2) April 20, 2026, Regular Meeting, Agenda Item #26-212 - The Board authorized staff to move forward with the necessary steps for a 2026 Bond Referendum to fund a new jail facility in the amount of $200,000,000. BACKGROUND: General Obligations Bonds (GO) are widely considered the lowest-interest, most cost-effective financing mechanism for long-term capital projects in North Carolina due to the pledge of the local government's full faith, credit, and taxing power. For North Carolina counties, which are legally required to provide secure, safe, and sanitary inmate housing, financing a jail through a GO bond ensures that the borrowing costs are minimized for the taxpayers, as these bonds typically secure better credit ratings than other debt options. The GO bond process is more rigorous than other financing options (requiring a public vote), however the interest savings from a GO bond make it the preferred tool for construction of a new jail. The Introduction of the Bond Order lays out the purpose of the general obligation bond referendum that will be placed on the November 3, 2026 election ballot and the Resolution will set the date for the Public Hearing required on July 20, 2026 and authorize the Clerk to the Board to publish the notice of the Public Hearing. FINANCIAL IMPACT: Union County, NC Printed on 6/1/2026Page 1 of 2 powered by Legistar™126 File #:26-329 Agenda Date:6/16/2026 The estimated cumulative cost over the life of the bond, using the highest interest rate of 5.344% charged for similar debt over the last twenty years is estimated at $312,224,000. The estimated maximum annual debt service payment is $20,688,000 beginning in FY 2028 and commencing in FY 2047. The annual estimated amount of property tax liability increases for each $100,000 of property tax value to service the cumulative cost over the life of the bond is estimated at $31.10. The annual estimated amount of property tax liability increases for each $400,000 of property tax value to service the cumulative cost over the life of the bond is estimated at $124.40 (based on 3.11¢ increase in the ad valorem property tax rate). These estimates are based on the legislative requirements of NC Session Law 2022-53 for bond referendums. Union County, NC Printed on 6/1/2026Page 2 of 2 powered by Legistar™127 PPAB 13665606v1 Commissioner _________________ introduced the following Bond Order, copies of which have been made available to the Board of Commissioners: BOND ORDER AUTHORIZING THE ISSUANCE OF $200,000,000 GENERAL OBLIGATION JAIL BONDS OF THE COUNTY OF UNION, NORTH CAROLINA WHEREAS, the Board of Commissioners of the County of Union, North Carolina (the “County”) has ascertained and hereby determines that it is necessary to pay the capital costs of providing for the design, construction, furnishing and equipping of a new jail facility; and WHEREAS, an application has been filed with the Secretary of the Local Government Commission of North Carolina requesting Local Government Commission approval of the General Obligation Jail Bonds hereinafter described as required by the Local Government Bond Act, and the Clerk to the Board of Commissioners has notified the Board of Commissioners that the application has been accepted for submission to the Local Government Commission. NOW, THEREFORE, BE IT ORDERED by the Board of Commissioners of the County of Union, North Carolina, as follows: Section 1. In order to raise the money required for the purposes described above, in addition to any funds which may be made available for such purpose from any other source, General Obligation Jail Bonds of the County are hereby authorized and will be issued pursuant to the Local Government Finance Act of North Carolina. The maximum aggregate principal amount of such General Obligation Jail Bonds authorized by this order will be $200,000,000. Section 2. Taxes will be levied in an amount sufficient to pay the principal and interest of the General Obligation Jail Bonds. Section 3. A sworn statement of the County’s debt has been filed with the Clerk to the Board of Commissioners and is open to public inspection. Section 4. This bond order will take effect when approved by the voters of the County at a referendum scheduled for November 3, 2026. The foregoing bond order was introduced by the Board of Commissioners of the County of Union, North Carolina this 16th day of June, 2026. Clerk to the Board Chairman APPROVED AS TO FORM: County Attorney 128 PPAB 13665606v1 STATE OF NORTH CAROLINA ) ) SS: COUNTY OF UNION ) I, Lynn West, Clerk to the Board of Commissioners of the County of Union, North Carolina, DO HEREBY CERTIFY the attached to be a true and correct copies of the Bond Order entitled, “BOND ORDER AUTHORIZING THE ISSUANCE OF $200,000,000 GENERAL OBLIGATION JAIL BONDS OF THE COUNTY OF UNION, NORTH CAROLINA” introduced by the Board of Commissioners of the County of Union, North Carolina at a meeting held on the 16th day of June, 2026. IN WITNESS WHEREOF, I have hereunto set my hand and affixed the corporate seal of said County, this the ____ day of June, 2026. (SEAL) Clerk to the Board of Commissioners County of Union, North Carolina 129 PPAB 13665606v1 RESOLUTION OF THE COUNTY OF UNION, NORTH CAROLINA REGARDING BOND ORDER AUTHORIZING THE ISSUANCE OF GENERAL OBLIGATION JAIL BONDS, SETTING PUBLIC HEARING THEREON AND DIRECTING PUBLICATION OF NOTICE OF SAID PUBLIC HEARING WHEREAS, bond order entitled: BOND ORDER AUTHORIZING THE ISSUANCE OF $200,000,000 GENERAL OBLIGATION JAIL BONDS OF THE COUNTY OF UNION, NORTH CAROLINA has been introduced at a meeting of the Board of Commissioners of the County of Union, North Carolina this 16th day of June, 2026; and WHEREAS, the Board of Commissioners desires to provide for the holding of public hearing thereon on July 20, 2026 and the submission of a statement of debt and a statement of disclosures in connection therewith as required by The Local Government Bond Act. NOW, THEREFORE, BE IT RESOLVED BY THE BOARD OF COMMISSIONERS OF THE COUNTY OF UNION, NORTH CAROLINA that the public hearing on said bond order shall be held on the 20th day of July, 2026 in the Union County Government Center, First Floor, Board Room, 500 North Main Street, Monroe, North Carolina at or about 6:00 p.m. BE IT FURTHER RESOLVED that the Clerk to the Board of Commissioners is hereby directed to cause a copy of said bond order to be published with a notice of such hearing in the form prescribed by law in a newspaper of general circulation in the County on or before the 11th day of July, 2026. BE IT FURTHER RESOLVED that before the public hearing, the County’s Finance Director is hereby directed to (1) file a sworn statement of debt with the Local Government Commission and the Clerk to the Board of Commissioners in accordance with Section 159-55 of the General Statutes of North Carolina and (2) file with the Clerk to the Board of Commissioners and the Local Government Commission of North Carolina and post online a statement of disclosure in accordance with Section 159-55.1(a) of the General Statutes of North Carolina. BE IT FURTHER RESOLVED that this Resolution shall become effective on the date of its adoption. 130 PPAB 13665606v1 READ, APPROVED AND ADOPTED this the 16th day of June, 2026. Clerk to the Board Chairman APPROVED AS TO FORM: County Attorney 131 PPAB 13665606v1 STATE OF NORTH CAROLINA ) ) SS: COUNTY OF UNION ) I, Lynn West, Clerk to the Board of Commissioners of the County of Union, North Carolina, DO HEREBY CERTIFY the attached to be a true and correct copy of a Resolution entitled, “RESOLUTION OF THE COUNTY OF UNION, NORTH CAROLINA REGARDING BOND ORDER AUTHORIZING THE ISSUANCE OF GENERAL OBLIGATION JAIL BONDS, SETTING PUBLIC HEARING THEREON AND DIRECTING PUBLICATION OF NOTICE OF SAID PUBLIC HEARING” adopted by the Board of Commissioners of the County of Union, North Carolina at a meeting held on the 16th day of June, 2026. IN WITNESS WHEREOF, I have hereunto set my hand and affixed the corporate seal of said County, this the ____ day of June, 2026. (SEAL) Clerk to the Board of Commissioners County of Union, North Carolina 132 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-344 Agenda Date:6/16/2026 TITLE:..title Authorization to Write Off Returned or Uncollectible Revenues INFORMATION CONTACT: Beverly L. Liles, Finance, Director, 704-283-3675 ACTION REQUESTED: Approve the write-off of returned or uncollectible revenues totaling $695.32. PRIOR BOARD ACTIONS: None. BACKGROUND: The Finance Department has conducted a review of outstanding returned revenues, including non- sufficient funds (NSF) checks. After reasonable and diligent efforts to collect these funds, the department has determined that these amounts are not recoverable. Accordingly, we are requesting Board approval to formally write off these amounts from the County’s financial records. FINANCIAL IMPACT: The total amount to be written off is $695.32. These funds have previously been recorded but are now deemed uncollectible. No additional budget appropriation is required. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™133 Memorandum Finance Department 500 N. Main Street Suite 709 Monroe, NC 28112 T 704.283.3813 unioncountync.gov To: Union County Board of Commissioners From: Union County Finance Department Date: June 16, 2025 Re: Request for Board Approval to Write Off Uncollectible Revenues The Finance Department has completed a comprehensive review of outstanding returned revenues, including non-sufficient funds (NSF) checks, closed accounts, and other payments that have been deemed uncollectible. Despite reasonable and diligent efforts to recover these funds, the department has determined that collection is no longer feasible. We are therefore requesting formal approval from the Board to write off these amounts from the County’s financial records. The total amount recommended for write-off is $19,409.47, which has previously been recorded in County accounts but is now considered unrecoverable. The breakdown of the uncollectible amounts is as follows: $334.00 – Parks and Recreation disputed claims $18,038.46 – UC Water revenue $1,037.01 – NSF checks • Ag Services - 31.62 • Building Code - $125.00 • Library - $10.00 • UCSO - $60.00 • Solid Waste - $314.70 • UC Water - $495.69 This action will not require any additional budget appropriation, as the amounts were previously recognized and reported. We appreciate your attention to this matter and request your approval to proceed with the write-off process as outlined. 134 Memorandum Union County Farmer’s Market 805 Skyway Dr Monroe, NC 28110 T 704.283.3626 unioncountync.gov To: Finance From: Kim Griffin Date: June 3, 2025 Re: NSF/Debt Write-Off Farmer’s Market has had checks from the following customers returned due to insufficient funds: Customer Check Date Amount Robert Hargette 10/23/2023 $31.62 Several Collection attempts have been made but to no avail. Considering the time and cost of further collection efforts, we ask that these checks to be written off. 135 From:Susie Calkins To:Ebru Cukro Cc:Kiara McClendon; Jennifer Tyson Subject:Building Code Enforcement NSF"s Date:Wednesday, May 28, 2025 9:30:33 PM Attachments:image003.png Building Code Enforcement has had check(s) from the following customer(s) returned due to insufficient funds: 6/21/2022 Ronald Hough $55.00 passed away and unable to collect 11/7/2022 Lyle Roger Roan $70.00 unable to collect 10/30/2022 Sarah Blackwell $100.00 collected 12/14/23 and redeposited 12/15/23 Several Collection attempts have been made but to no avail. Considering the time and cost of further collection efforts, we ask that these checks be written off. Please let me know if you need anything else. Susie Calkins Business Manager | Building Code Enforcement T 704.283.3509 susie.calkins@unioncountync.gov www.unioncountync.gov Union County Government 500 North Main Street, Suite 47 Monroe, NC 28112 E-mail correspondence to and from this sender may be subject to the North Carolina Public Records law and may be disclosed to third parties. If you are not the intended recipient of this e-mail, please contact the sender immediately. 136 unioncountync.gov/library Memorandum Union County Main Library 316 East Windsor St. Monroe, NC 28112 T 704.283.8184 To: Finance Department From: Matthew Killough Date: May 16, 2025 Re: NSF/ Debt Write-Off ______________________________________________________________________ The Library has had a check from the below patron returned due to insufficient funds: Customer Check Date Amount Andrew Phibbs 11/18/2021 $10 Collection attempts have been made to no avail. Considering the time and cost of further collection efforts, we ask that this check be written off. Thank you. 137 Memorandum Solid Waste 2125 Austin Chaney Rd. Wingate, NC 28174 T 704.296.4234 unioncountync.gov To: Finance From: Lindsay Helms Date: May 15, 2025 Re: NSF/Debt Write-Off Solid Waste has had checks from the following customers returned due to insufficient funds: Customer Check Date Amount Kaicey A Stack 8/25/2021 $ 10.00 Joshua Helms 9/23/2021 $ 40.00 Peggy Ann Banks 11/18/2021 $ 10.00 Ronald Helms 12/17/2021 $ 20.00 Sarah N Mangum 6/7/2022 $ 8.25 Furbabies Animal Rescue 9/1/2022 $ 30.00 Skye Evans 10/11/2022 $ 67.20 Jeff Furr 12/1/2022 $ 10.00 Triston Helms 1/9/2023 $ 10.00 Amber Wilken 2/3/2023 $ 4.25 Mark Hill 4/14/2023 $ 20.00 Wendy Gill 10/6/2023 $ 10.00 Initium Construction Group LLC 4/22/2024 $ 5.00 Initium Construction Group LLC 9/16/2024 $ 20.00 Alexander Banks 12/5/2023 $ 10.00 Michael Staton 3/22/2024 $ 30.00 Abigail Leigh Eudy 5/7/2024 $ 10.00 Several Collection attempts have been made but to no avail. Considering the time and cost of further collection efforts, we ask that these checks to be written off. 138 139 Union County Water Street Address City, State ZIP T 555.555.5555 unioncountync.gov/water To: Finance From: Zachary Tarlton, Business Manager, UC Water Date: 5/29/2025 Re: NSF/Debt Write-Off Union County Water has had check(s) from the following customer(s) returned due to insufficient funds: Customer Check Date Amount Joanne Slynn 4/29/2022 $183.69 Shavonia M Brace 6/3/2022 $100.00 Michael H Davis 5/7/2024 $10.00 Patricia McLeod Chambers 6/6/2024 $102.00 Sarah M Hersey 6/25/2024 $100.00 Several collection attempts have been made but to no avail. Considering the time and cost of further collection efforts, we ask that these checks be written off. 140 704.283.3885 | 5213 Harkey Road, Waxhaw, NC 28173 | unioncountync.gov/parks TO: FINANCE FROM: LINDSEY BRASWELL PARKS & RECREATION DATE: APRIL 2, 2025 RE: OUTSTANDING BANK TRANSACTIONS Currently, the Parks and Recreation Department has three outstanding bank transactions for a total of $334 that need to be written off if possible. All three transactions were for one camping customer who was frequently in the campground. He submitted a claim through his credit card company stating that we had refused a refund when he tried to cancel. After internal investigation, we discovered he did stay all three instances. When he was presented with this information and asked about his claim, he stated it must have been a family member who was also an approved user on the card who refuted the charges. The credit card company was contacted, and they requested proof of occupancy through contract. Staff decided to disallow future credit card transactions from the customer and not investigate further. Thanks. 141 Union County Water Street Address City, State ZIP T 555.555.5555 unioncountync.gov/water To: Finance From: Zachary Tarlton, Business Manager, UC Water Date: 6/16/2025 Re: UC Water ACH Returns Union County Water has carried over ACH returns for several years that have been unable to locate in Harris Northstar and correctly applied to customer accounts. As a result, we are carrying $18,038.46 in unresolved returns. Given the time burden on staff and inability to clear this balance over several years, we are requesting permission to write off this balance so that UC Water can enter FY26 with a zero dollar balance in ACH returns. This will allow us to better track, monitor, and reconcile any forthcoming returns in our system. This memo serves as a formal request for Finance to include a write off in the amount of $18,038.46 in UC Water ACH Returns. 142 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-324 Agenda Date:6/16/2026 TITLE:..title April 2026 NCVTS Motor Vehicle Tax Report INFORMATION CONTACT: Vann Harrell, Tax Administration, Tax Administrator, 704-283-3748; Kristen Foxworth, Tax Administration, Deputy Tax Administrator, 704-283-3591 ACTION REQUESTED: Approve the April 2026 NCVTS Motor Vehicle Tax Refund Report. PRIOR BOARD ACTIONS: None. BACKGROUND: The refunds included in this report represent adjustments made to tax bills that resulted in refunds of motor vehicle taxes paid under the Tax and Tag Together program operated jointly between the counties and the State. FINANCIAL IMPACT: $1,579.07 Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™143 Payee Name Secondary Owner Address 1 Address 3 Refund Type Bill #Plate Number Status Transaction #Refund Description Refund Reason Create Date Authorization Date Tax Jurisdiction Levy Type Change Interest Change 001 TAX $0.00 $0.00 600 TAX $91.64 $0.00 200 TAX ($237.18)$0.00 200 VEHICLE FEE ($30.00)$0.00 020 TAX $24.90 $0.00 003 TAX $0.00 $0.00 005 TAX $0.00 $0.00 004 TAX $0.00 $0.00 002 TAX $0.00 $0.00 Refund 001 TAX $0.00 $0.00 600 TAX $149.60 $0.00 200 TAX ($387.20)$0.00 200 VEHICLE FEE ($30.00)$0.00 020 TAX $40.66 $0.00 003 TAX $0.00 $0.00 005 TAX $0.00 $0.00 004 TAX $0.00 $0.00 002 TAX $0.00 $0.00 Refund 001 TAX $0.00 $0.00 200 TAX ($87.74)$0.00 200 VEHICLE FEE ($30.00)$0.00 013 TAX $3.45 $0.00 003 TAX $0.00 $0.00 005 TAX $0.00 $0.00 004 TAX $0.00 $0.00 002 TAX $0.00 $0.00 Refund 001 TAX ($54.52)$0.00 500 TAX ($140.65)$0.00 500 VEHICLE FEE $0.00 $0.00 028 TAX ($22.31)$0.00 003 TAX ($5.14)$0.00 005 TAX ($2.19)$0.00 004 TAX ($18.87)$0.00 002 TAX ($129.88)$0.00 Refund 001 TAX $0.00 $0.00 200 TAX ($209.57)$0.00 200 VEHICLE FEE ($30.00)$0.00 980 TAX $9.53 $0.00 021 TAX $25.72 $0.00 003 TAX $0.00 $0.00 005 TAX $0.00 $0.00 004 TAX $0.00 $0.00 002 TAX $0.00 $0.00 Refund 001 TAX $0.00 $0.00 400 TAX ($158.20)$0.00 018 TAX $0.00 $0.00 003 TAX $0.00 $0.00 005 TAX $0.00 $0.00 004 TAX $0.00 $0.00 002 TAX $0.00 $0.00 Refund 001 TAX $0.00 $0.00 400 TAX ($195.75)$0.00 018 TAX $26.19 $0.00 003 TAX $0.00 $0.00 005 TAX $0.00 $0.00 004 TAX $0.00 $0.00 002 TAX $0.00 $0.00 Refund 001 TAX $0.00 $0.00 200 TAX ($167.85)$0.00 200 VEHICLE FEE ($30.00)$0.00 023 TAX $16.29 $0.00 003 TAX $0.00 $0.00 005 TAX $0.00 $0.00 004 TAX $0.00 $0.00 002 TAX $0.00 $0.00 Refund Refund Total AIR CENTRAL OF THE CAROLINAS LLC AIR CENTRAL OF THE CAROLINAS LLC PO BOX 1816 North Carolina Vehicle Tax System Pending Refund Report Primary Owner Address 2 Total Change 1103621823 Refund Generated due to adjustment on Bill #0089965142- 2025-2025-0000 Situs error 4/9/2026STALLINGS, NC 28104 Adjustment >= $100 0089965142 AA3277E PENDING $0.00 $0.00 $0.00 $0.00 $150.64 $0.00 $91.64 ($237.18) ($30.00) $24.90 $0.00 $149.60 ($387.20) ($30.00) $40.661103312691 Refund Generated due to adjustment on Bill #0089967122- 2025-2025-0000 Situs error 4/8/2026 CRUZ ESPINOSA, ALFREDO CRUZ ESPINOSA, ALFREDO 2509 PLYLER MILL RD $0.00 $0.00 $0.00 $0.00 $226.94 INDIAN TRAIL, NC 28079 Adjustment >= $100 0089967122 BB1542A PENDING CARTIER CLASSIC TRANSPORTATIO N LLC CARTIER CLASSIC TRANSPORTATIO N LLC 115 UNIONVILLE INDIAN TRAIL SUITE B8 980722312 Refund Generated due to adjustment on Bill #0090332212- 2025-2025-0000 Situs error 4/8/2026MONROE, NC 28112 Adjustment >= $100 0090332212 JMF4288 PENDING $0.00 $0.00 $0.00 $114.29 $0.00 ($87.74) ($30.00) $3.45 $0.00 ($54.52) ($140.65) $0.00 ($22.31) ($5.14)980356992 Refund Generated due to adjustment on Bill #0090343834- 2025-2025-0000-00 Exempt Property 4/6/2026 SEROV, VASILII SEROV, VASILII 1224 PRESSON FARMS LN ($2.19) ($18.87) ($129.88) $373.56 WAXHAW, NC 28173 Adjustment >= $100 0090343834 VFP7233 PENDINGNISIUS, GREGORY ERIC NISIUS, GREGORY ERIC 5004 BRITANNIA BLVD PO BOX 601 $0.00 $0.00 $0.00 $0.00 $204.32 $0.00 ($209.57) ($30.00) $9.53 $25.721103621634 Refund Generated due to adjustment on Bill #0089962112- 2025-2025-0000 Situs error 4/9/2026UNIONVILLE, NC 28110 Adjustment >= $100 0089962112 MCA8922 PENDING $0.00 ($158.20) $0.00 $0.00 $0.00860889743 Refund Generated due to adjustment on Bill #0082371788- 2025-2025-0000 Situs error 4/22/2026 $0.00 $0.00 $158.20 TALBERT, CEILIA STEGALL TALBERT, CEILIA STEGALL PO BOX 601 MARSHVILLE, NC 28103 Adjustment >= $100 0082371788 VCR7951 PENDING 860889750 Refund Generated due to adjustment on Bill #0082371788- 2024-2024-0000 MARSHVILLE, NC 28103 Adjustment >= $100 0082371788 VCR7951 PENDING TALBERT, CEILIA STEGALL TALBERT, CEILIA STEGALL TERMINIX SERVICE INC. TERMINIX SERVICE INC.PO BOX 2627 Situs error 4/22/2026 $0.00 ($195.75) $26.19 $0.00 $0.00 $0.00 $0.00 $169.56 $0.00 ($167.85) ($30.00) $16.29 $0.00980997168 Refund Generated due to adjustment on Bill #0089983813- 2025-2025-0000 Situs error 4/9/2026 $1579.07 $0.00 $0.00 $0.00 $181.56 COLUMBIA, SC 29202 Adjustment >= $100 0089983813 MBJ5224 PENDING Page 1 of 1 144 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-348 Agenda Date:6/16/2026 TITLE:..title Contract Renewal - Microsoft Enterprise Agreement INFORMATION CONTACT: Jon Amelio, Information Technology, Director, 704-283-3533 ACTION REQUESTED: Authorize the County Manager to 1) negotiate and execute an agreement substantially consistent with this agenda item, 2) exercise any renewal or extension term options set forth in the Agreement, and 3) terminate the Agreement if deemed in the best interest of the County, each in the County Manager's discretion. PRIOR BOARD ACTIONS: None BACKGROUND: This is the County's Enterprise Agreement Renewal for Microsoft. This contract covers all aspects of our Microsoft Cloud and on-premises environment, from user subscriptions to back-end server maintenance and SQL Server clustering. FINANCIAL IMPACT: Price to be determined after June 1st on forthcoming quote. Need on agenda for June 16th. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™145 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-349 Agenda Date:6/16/2026 TITLE:..title Resolution - Updates to the Union County Personnel Resolution INFORMATION CONTACT: Julie Broome, Human Resources, Director, 704-283-3869 ACTION REQUESTED: Adopt the revised Union County Personnel Resolution, effective July 1, 2026. PRIOR BOARD ACTIONS: None. BACKGROUND: Updates to the Personnel Resolution are recommended at times to address terminology changes, organizational alignment, county management operational needs, and Board of County Commissioners direction. The recommended revised Union County Personnel Resolution (“UCPR”) includes the following revisions to the existing UCPR: ·Technical, terminology, and practical revisions throughout the UCPR to correspond with current terminology, organizational structure, practice, and applicable law ·Clarification and streamlining of the County Manager’s authority concerning department reorganizations ·Clarification and improvements concerning the administration of the pay plan in certain circumstances ·Updates to uniformed services (military) leave policy ·Added provisions to allow oral fluid (saliva) drug testing in certain circumstances FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™146 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-340 Agenda Date:6/16/2026 TITLE:..title Minutes for Approval INFORMATION CONTACT: Lynn G. West, Clerk to the Board of Commissioners, 704-283-3853 ACTION REQUESTED: Approve minutes PRIOR BOARD ACTIONS: None BACKGROUND: Draft minutes have been provided to the Board for review and approval. FINANCIAL IMPACT: None Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™147 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-325 Agenda Date:6/16/2026 TITLE:..title Tax Collector’s Departmental Report for April 2026 INFORMATION CONTACT: Kristen Foxworth, Tax Administration, Deputy Tax Administrator, 704-283-3591 ACTION REQUESTED: None - Information Only. PRIOR BOARD ACTIONS: None. BACKGROUND: This report reflects the totals of all tax transactions within the Tax Collector’s Office for the month of April 2026 as required by NCGS 105-350(7). FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™148 Tax Administration | Revenue Division 500 North Main Street, Suite 119 Monroe, NC 28112 T 704-283-3848 unioncountync.gov Memorandum To: Board of County Commissioners Brian Matthews, County Manager Lynn West, Clerk to the Board From: Vann Harrell Tax Administrator Date: May 12, 2026 Re: Departmental Monthly Report The Tax Collector’s monthly/year to date collections report for the month ending April 30, 2026 is attached for your information and review. Should you desire additional information, I will provide that at your request. Attachment VH/JM 149 APRIL 2026 PERCENTAGE FOR REGULAR TAX APRIL 30, 2026 REGULAR TAX 2026 2025 2024 2023 2022 BEGINNING CHARGE 536,355.42 274,844,406.12 237,285,195.77 226,218,530.63 217,100,216.02 TAX CHARGE PUBLIC UTILITIES CHARGE DISCOVERIES 76,944.18 NON DISCOVERIES 34,619.81 4,861.07 3,033.76 2,959.28 236.13 RELEASES (1,105.44) (6,291.85) (366.62) (379.63) (380.57) TOTAL CHARGE 646,813.97 274,842,975.34 237,287,862.91 226,221,110.28 217,100,071.58 BEGINNING COLLECTIONS 121,404.41 273,352,397.84 237,135,256.40 226,137,347.61 217,047,204.43 COLLECTIONS 21,277.10 750,710.51 11,305.98 6,320.60 4,039.72 TOTAL COLLECTIONS 142,681.51 274,103,108.35 237,146,562.38 226,143,668.21 217,051,244.15 BALANCE OUTSTANDING 504,132.46 739,866.99 141,300.53 77,442.07 48,827.43 PERCENTAGE OF REGULAR 22.06%99.73%99.94%99.97%99.98% OVERALL CHARGED 646,813.97 274,842,975.34 237,287,862.91 226,221,110.28 217,100,071.58 OVERALL COLLECTED 142,681.51 274,103,108.35 237,146,562.38 226,143,668.21 217,051,244.15 OVERALL PERCENTAGE 22.06%99.73%99.94%99.97%99.98% 1 150 APRIL 2026 PERCENTAGE FOR REGULAR TAX APRIL 30, 2026 REGULAR TAX BEGINNING CHARGE TAX CHARGE PUBLIC UTILITIES CHARGE DISCOVERIES NON DISCOVERIES RELEASES TOTAL CHARGE BEGINNING COLLECTIONS COLLECTIONS TOTAL COLLECTIONS BALANCE OUTSTANDING PERCENTAGE OF REGULAR OVERALL CHARGED OVERALL COLLECTED OVERALL PERCENTAGE 2021 2020 2019 2018 208,193,368.98 192,181,155.30 186,540,147.30 180,717,811.44 (359.21) (232.13) 208,193,009.77 192,180,923.17 186,540,147.30 180,717,811.44 208,144,231.60 192,113,137.87 186,444,741.58 180,661,614.46 1,938.50 676.92 1,060.75 1,096.50 208,146,170.10 192,113,814.79 186,445,802.33 180,662,710.96 46,839.67 67,108.38 94,344.97 55,100.48 99.98%99.97%99.95%99.97% 208,193,009.77 192,180,923.17 186,540,147.30 180,717,811.44 208,146,170.10 192,113,814.79 186,445,802.33 180,662,710.96 99.98%99.97%99.95%99.97% 2 151 APRIL 2026 PERCENTAGE FOR REGULAR TAX APRIL 30, 2026 REGULAR TAX BEGINNING CHARGE TAX CHARGE PUBLIC UTILITIES CHARGE DISCOVERIES NON DISCOVERIES RELEASES TOTAL CHARGE BEGINNING COLLECTIONS COLLECTIONS TOTAL COLLECTIONS BALANCE OUTSTANDING PERCENTAGE OF REGULAR OVERALL CHARGED OVERALL COLLECTED OVERALL PERCENTAGE 2017 2016 186,663,147.61 176,859,604.37 186,663,147.61 176,859,604.37 186,617,140.04 176,822,068.93 1,200.26 1,112.42 186,618,340.30 176,823,181.35 44,807.31 36,423.02 99.98%99.98% 186,663,147.61 176,859,604.37 186,618,340.30 176,823,181.35 99.98%99.98% 3 152 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-342 Agenda Date:6/16/2026 TITLE:..title Communications Monthly Report - May 2026 INFORMATION CONTACT: Liz Cooper, Public Communications, Director, 704-283-3587 ACTION REQUESTED: None - Information Only. PRIOR BOARD ACTIONS: None. BACKGROUND: This report provides valuable metrics and insights into communication platforms and our efforts to collaborate with all County departments to inform and engage residents, promote programs and services, and strengthen internal and external communications. FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™153 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-346 Agenda Date:6/16/2026 TITLE:..title Facilities Major Capital Projects Update - Quarterly Report INFORMATION CONTACT: Linda Whitaker, Assistant Director Design and Construction, Facilities & Fleet Management, 704-420- 2626 ACTION REQUESTED: None - Information Only. PRIOR BOARD ACTIONS: None. BACKGROUND: This is the quarterly major capital projects update for projects managed by the Facilities & Fleet Management Department. FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™154 MAJOR CAPITAL (MC) JUNE 16, 2026 Quarterly Facilities Capital Projects Update 155 Project Partners Development and financial responsibility for entry roads and other infrastructure Edifice CMAR 1 2 Funding Source 5 NCDA FP Grant2 500,000.00$ 5/7/2026 Notes:County has applied for a future NCDA FP Grant of $ 500,000.00 PreDesign Design Contracts/Bidding Permitting, Construction Closeout Schedule Breakdown 1,810,959.00$ 505,760.00$ NCDOT Permit - Permit Application Review in Progress Last Qtr GMP Board Approval, Permitting Next Qtr Permitting, Construction Start Unique Schedule Impacts:Land Lease with Wingate University - Lease executed Business Park road and infrastructure development by Town of Wingate - Plans developed by October, 2025 Grant Award for kitchen equipment, cold storage, shelving/racks - Grant awarded City of Monroe - Natural Gas Infrastructure Construction - Proposal Under Review State Grant Investment Earnings Jan 2024 - Mar 2024 Apr 2024 - Oct 2025 Nov 2025 - Jan 2026 Feb 2026 - Mar 2027 Mar 2027 - Mar 2028 Transfer from Facilities Capital 19,196.00$ Total Revenue $17,380,604 Project Budget Delta $519,535 Project Revenue Funding Source 7 Intergovernmental Revenue (Wingate) Funding Source 8 Funding Source 6 Soft Costs $965,921 Funding Source 3 Transfer from General Fund 476,243.00$ Construction $15,895,148 Funding Source 4 GoldenLEAF Grant1 1,000,000.00$ Project Total $16,861,069 Funding Source 2 UC/EDC Capital 7,447,087.00$ Providing $5,000,000 in funding Construction NC Cooperative Extension Management of day to day operations Budget Revenue Budget Breakdown Funding Source 1 State Appropriation 5,000,000.00$ Current Phase 20.0%6 Mnth Lag 3/1/2027 2%5%21,452 gsf $17,380,604Funding Source 9 Bond Interest Income 621,359.00$ Project Budget PM: Bruno $17,380,604 Town of Wingate Wingate University Land lease, curriculum development and sharing, scholarship commitment Project Name Project Description Capital Account Union County Food Innovation Center Design and construct a facility to support an incubator space for local food product development, production and packaging. The facility is planned to be between 15,000 to 30,000 gsf with key features including: dry storage, cold storage, commercial kitchens, food processing suites, wash stations, food packaging rooms, office space, food truck parking. 40080187 CPL Architect Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Building Size Current Phase State of North Carolina 156 Responsible for daily operations of new facility Last Qtr Construction Documents phase completed, CD phase estimate and value management reviewed and approved. Begin Permitting. Next Qtr Site Plan Reviewed and Approved. Submit Construction Documents to Permitting. 100% Permit Approvals. Build the Bid Package. Unique Schedule Impacts:Site and long lead time packages to bid early. Layout configuration review by UC Leadership. PreDesign Design Contracts/Bidding Construction Closeout Schedule Breakdown Aug 2024 - Feb 2025 Feb 2025 - June 2026 June 2026 - Sept 2026 Oct 2026 - Nov 2027 Nov 2027 - Nov 2028 Future Funding Source 3 Project Contingency $217,307 Total Future Funding $0 Project Total $15,498,394 Future Funding Source 1 D/C Subtotal $14,980,677 Future Funding Source 2 Owner Reserves $300,410 Total Revenue $15,500,140 Furniture/Fixed Equipment $946,760 Construction Contingency $297,307 Funding Source 2 Design $865,260 Funding Source 3 Construction $12,871,350 Budget Revenue Budget Breakdown Funding Source 1 UC WATER Capital $15,500,140 Current Phase Building Size 15.0%8 Wks Lag 11/26/2027 5%4%20,142 gsf Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Edifice CMAR Design/Construction Documents Project Budget $15,500,140 UC Water Department Progressive Design Architect Project Name Project Description Capital Account UC Water Operation Center Expansion and Renovation Design and construct a facility to support UC Water growing needs. The project is proposed to be constructed on the premises of the current operations center in Monroe. The anticipated building size is approximately 30,000 gsf and will contain general offices for Administration, Engineering, Operations, Customer Service that includes customer drive-thru for various transactions and Warehouse space. In addition to this, a renovation of approximately 3,000 gsf of existing Ops Center. 60186019 Project Partners PM: Soto 02.02.2026 157 Responsible for daily operation of new facility Last Qtr Construction completed. Store opened on April 2nd. Next Qtr Unique Schedule Impacts:None PreDesign Design Contracts/Bidding Construction Closeout Schedule Breakdown Aug 2022 - Nov 2022 Nov 2022 - Apr 2024 Apr 2024 - Jan 2025 Feb 2025 - Nov 2025 Nov 2025 - Nov 2026 Future Funding Source 3 Project Contingency $0 Total Future Funding $0 Project Total $938,588 Future Funding Source 1 D/C Subtotal $938,588 Future Funding Source 2 Owner Reserves Total Revenue $950,000 Furniture/Fixed Equipment $17,451 Construction Contingency $78,221 Funding Source 2 Interest Income $100,000 Design $60,700 Funding Source 3 Event Ctr Support Fac $250,000 Construction $782,216 Budget Revenue Budget Breakdown Funding Source 1 UC Capital MC $600,000 Current Phase Building Size 100.0%0 Wks Lag 11/15/2025 7%93%3,588 gsf Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Rushing Contracting General Contractor Closeout/Warranty Project Budget $950,000 UC Parks and Recreation Creech & Associates Architect Project Name Project Description Capital Account UC Cane Creek Campground Store Design and Construction of a new building of approximately 1,300 SF that will serve as a general store for the Cane Creek Park Campground area. 40080100 Project Partners PM: Soto 02.02.2026 158 Project Partners Responsible for daily operations of new facility Last Qtr Construction Documents phase completed, begin Permitting process. Next Qtr Permitting completed, begin bidding process. Unique Schedule Impacts:Permitting process. New building location - coordination with utilities. Size and location of the current septic system. PreDesign Design Contracts/Bidding Construction Closeout Schedule Breakdown Feb 2025 - Jun 2025 Jun 2025 - June 2026 July 2026 - Oct 2026 Nov 2026 - July 2027 July 2027 - July 2028 Future Funding Source 3 Project Contingency $192,000 Total Future Funding $0 Project Total $3,262,300 Future Funding Source 1 D/C Subtotal $3,070,300 Future Funding Source 2 Owner Reserves Total Revenue $3,350,000 Furniture/Fixed Equipment $204,000 Construction Contingency $192,000 Funding Source 2 Design $174,300 Funding Source 3 Construction $2,500,000 Budget Revenue Budget Breakdown Funding Source 1 UC Solid Waste MC $3,350,000 Current Phase Building Size 20.0%4 Wks Lag 7/30/2027 1%99%6,000 gsf Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase TBD General Contractor Design/Construction Documents Project Budget $3,577,000 UC Solid Waste McMillan Pazdan Smith Architect Project Name Project Description Capital Account UC Solid Waste Operation Center Design and construct a facility to replace the existing office administrative building. The facility is planned to be a single story building between 5,000 to 6,000 gsf with key features including: nine offices, two showers, two bathrooms, one kitchenette area, one conference room, one MEP room, one storage room, one lobby for dirty entry and one lobby for clean entry. 61287000 PM: Soto 02.02.2026 159 Project Partners Historic tree protection advice Construction Document Complete, bidding Last Qtr Next Qtr Schematic/Design Development phase completed, Construction Documents started Unique Schedule Impacts:Coordinating construction with the congressmen's office. Coordinating HVAC & waterproofing to maintain occupancy Coordinating construction work and historic tree preservation PreDesign Design Contracts/Bidding Construction Closeout Schedule Breakdown Feb 2025 - May 2025 Apr 2025 - May 2026 May 2026 - Aug 2026 Aug 2026 - Jun 2027 Jun 2027 - Jun 2028 Total Future Funding $0 Project Total $1,725,000 Future Funding Source 2 Owner Reserves $209,730 Future Funding Source 3 Project Contingency $80,000 Construction Contingency $116,000 Future Funding Source 1 D/C Subtotal $1,435,270 Total Revenue $1,725,000 Furniture/Fixed Equipment $0 Funding Source 2 Design $199,270 Funding Source 3 Construction $1,120,000 Budget Revenue Budget Breakdown Funding Source 1 UC Capital MC $1,725,000 Current Phase Building Size 10.0%12 Wks Lag 6/1/2027 7%5%0 Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Walter Robbs Architect Design/Construction Documents TBD General Contractor Project Budget $1,725,000 UC Urban Forestry UC Historical Society Advisory only Project Name Project Description Capital Account Historic Courthouse - Phase 2 Design and construct envelope repairs to windows, doors foundations drainage, water infiltration into lower level, low slope roof replacement and structural reinforcement under HVAC units, portico roof repair/replacement, wraught iron repair. 40080125 PM: Bruno 02.02.2026 160 Project Partners Supplied $20M in grant funding CPL Architect Last Qtr Next Qtr Construction Design Development 95%, NCDEQ & NCDOT Permitting, Early Electrical Equipment Package approved by BOCC GMP Bidding, Permitting, Existing Structure Demo, Procurement of Lodox X-Ray Equipment, Early Electrical Equipment Procurement. Unique Schedule Impacts: Early bid packages will bid in January 2026 with full construction package bidding in July 2026 Advance Planning Design Contracts/Bidding Construction Closeout DOT coordination with Hwy 74 driveway/entrance Future Funding Source 3 Project Contingency $0 Schedule Breakdown Jun 2025 - Aug 2025 Aug 2025 - May 2026 May 2026 - Jul 2026 Aug 2026 - Nov 2027 Nov 2027 - Nov 2028 Total Future Funding $0 Project Total $20,980,429 Construction Contingency $515,378 Future Funding Source 1 D/C Subtotal $20,603,916 Future Funding Source 2 Owner Reserves $376,513 Total Revenue $21,037,481 Furniture/Fixed Equipment $1,075,000 Funding Source 2 ME Operation Funds $537,481 Design $1,834,283 Funding Source 3 $500,000 Construction $17,179,255 Budget Revenue Budget Breakdown Funding Source 1 State of NC Grant $20,000,000 Current Phase Building Size 15.0%2 Wks Lag 11/1/2027 5%5%15,100 sf Timmons Civil Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Design/Construction Documents Wharton-Smith CMAR Project Budget $20,537,481 State of NC UC Medical Examiner Responsible for operations Project Name Project Description Capital Account South Piedmont Regional Autopsy Center The project consists of constructing a new single-story, approximately 10,000-15,000 sf building in Wingate, NC to provide morgue and forensic pathology services to the residence of Union County as well as several surrounding Counties. The office will also be responsible for death investigations under certain circumstances and work with local, state and federal law enforcement agencies when necessary. The new facility will include autopsy stations, observation rooms, examination rooms, lab space biological processing equipment refrigeration space three to four offices, a small conference area, comprehensive ventilation and air conditioning and enhanced security. 40080222 10114420 PM: Bruno 5/7/2026 161 A&E Receive revised drawings and permits, start receiving quotes for finishes, issuing PO's, start installing finishes. 1 2 Notes:demo complete in lobby restrooms Last Qtr Next Qtr All punch list items complete except for 1. Working on design and cost for lobby restroom remodel, architect is revising the drawings for perm Unique Schedule Impacts:Temporarily relocating existing security desk and routing staff and visitor entrance to the ground floor during construction Offer visitors and Commissioners secure 1st floor access for Board meetings during construction PreDesign Design Contracts/Bidding Construction Closeout Schedule Breakdown May 2024 - Jan 2025 Jan 2025 - May 2025 July 2025 - Jan 2026 Jan 2026 - Jan 2027 Total Future Funding $0 Project Total $462,891 Future Funding Source 2 Owner Reserves Future Funding Source 3 Project Contingency $0 Construction Contingency $34,990 Future Funding Source 1 D/C Subtotal $462,891 Total Revenue $574,167 Furniture/Fixed Equipment $0 Funding Source 2 UC FRR $183,118 Design $38,261 Funding Source 3 UC Capital MC $289,552 Construction $389,640 Budget Revenue Budget Breakdown Funding Source 1 UC OC $101,497 Current Phase Building Size 95.0%0 Wks Lag 01.30.2026 13%87%0 Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Assa Abloy Equimpent Provider Closeout/Warranty UC Public Communications Project Budget Project Partners $574,167 Gensler Heartland Contracting General Contractor Project Name Project Description Capital Account UC Government Center First Floor Finishes and Lobby Renovation Project scope consists of renovating the Government Center's main entrance and lobby to offer a well organized entrance and exit scheme to better serve employees and the public, and includes security enhancements within a new security desk, visitor management system and the addition of security tunstiles. Adjacent spaces, the main corridor, commissioners conference room, kitchenette and board room will receive new wall and flooring finishes. 40080131, 40080069 and 40080190 PM: Simpson 05.07.2026 162 1 2 Notes: Last Qtr Generator arrived to the contractor on 03/26/2026, Hinson Electric has started installing the MDP, ATS and running conduit Next Qtr Continue construction, test generator, ATS, and MTS Unique Schedule Impacts: PreDesign Design Contracts/Bidding Construction Closeout Schedule Breakdown 4/24/2025 - 6/12/2025 6/19/2025 - 8/29/2025 9/1/25 - 1/21/2026 1/27/2026 - 8/8/2026 8/9/2026 - 8/9/2027 Future Funding Source 3 Project Contingency Total Future Funding $0 Project Total $510,800 Future Funding Source 1 D/C Subtotal $510,800 Future Funding Source 2 Owner Reserves Total Revenue $525,000 Furniture/Fixed Equipment Construction Contingency $43,800 Funding Source 2 Design $29,000 Funding Source 3 Construction $438,000 Budget Revenue Budget Breakdown Funding Source 1 UC Capital Funds $525,000 Current Phase Building Size 40.0%Lead 4 weeks 8/8/2026 92%5% Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Construction Project Budget Project Partners $525,000 Progressive AE Electrical Engineer/Designer 05/06/2026 Hinson Electric Electrical Contractor Project Name Project Description Capital Account Progress Generator Add an emergency generator to power the building in the event of normal power loss 40080209 PM: Simpson 163 Union County Sheriff's Department 1 2 Project Budget Project Partners $675,000 Project Name Project Description Capital Account Union County Sheriff's Office Fuel Station The project scope of work includes providing a 12,000-gallon fuel tank, dispensing system, and associated equipment. A three-sided enclosure will be constructed to conceal the fuel tank. The fuel management system will integrate with Union County’s existing fuel management system. Other accessory work includes replacing a section of asphalt with concrete, installing speed bumps to assist spill containment and traffic calming, and installing a security camera for area surveillance. 40080210 PM: Mangum 10.02.2025 Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Design/Construction Documents Budget Revenue Budget Breakdown Funding Source 1 UC MC $675,000 Current Phase Building Size 20.0%0 Wks Lag 1/1/2026 1%1%12,000 gal Total Revenue $675,000 Furniture/Fixed Equipment $0 Construction Contingency $33,868 Funding Source 2 Design $12,000 Funding Source 3 Construction $391,067 Future Funding Source 1 D/C Subtotal $436,935 Future Funding Source 2 Owner Reserves Future Funding Source 3 Project Contingency $0 Total Future Funding $0 Project Total $436,935 Schedule Breakdown 1/1/2024 -3/1/2024 3/1/2024 - 8/31/2024 10/1/2024- 12/1/2024 10/1/2024- 12/1/2024 1/1/2026 - 3/1/2026 Unique Schedule Impacts:Contract Cancel due to bid contention an abnormality Currently Manuals are in contract review and BOCC agenda meeting for May 18 PreDesign Design Contracts/Bidding Construction Closeout Notes: Last Qtr Reducing scope with engineer /firm, Working on bidding process (Contract Book, Bid requirments) Next Qtr Receiving signed porject manuals and schedule project 164 1 2 Notes:Consensus is needed from UC and the City of Fairview regarding access to the back of the property. City of Fairview will pay utility bills. Last Qtr Permit approved. Bidding process completed and rejected. Next Qtr Rebid project, Award construction contract. Unique Schedule Impacts:Evaluation of specification compliance on bid submissions. PreDesign Design Contracts/Bidding Construction Closeout Schedule Breakdown 6/13/2024 - 1/29/2025 2/10/2025 - 1/30/2026 4/14/2026 - 8/14/2026 9/01/2026 - 8/20/2027 8/20/2027 - 8/20/2028 Future Funding Source 3 Project Contingency $0 Total Future Funding $0 Project Total $2,023,830 Future Funding Source 1 D/C Subtotal $2,023,830 Future Funding Source 2 Owner Reserves Total Revenue $2,000,000 Furniture/Fixed Equipment $0 Construction Contingency $0 Funding Source 2 UC Facilites Capital $600,000 Design $123,830 Funding Source 3 Construction $1,900,000 Budget Revenue Budget Breakdown Funding Source 1 UC MC $1,400,000 Current Phase Building Size 20.0%6 Wks Lag 8/20/2027 2%9%1,120 gsf Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Progressive AE Architect Design/Construction Documents Project Budget Project Partners $2,000,000 City of Fairview Fairview Fire Station Project Name Project Description Capital Account UC Fairview Fire Training Facility Design and construct a facility to support variable training exercises practiced by the fire department, some of these training exercises are designed specifically for repeated Class “A” Fueled Live Fire Training, include an SCBA Reconfigurable Maze System allowing the interior floor space to be reconfigured to support various interior fire attack scenarios. The work shall be completed in two phases, includes coordinating with Union County Facilities Department for access, delivery, and installation. 40080176 PM: Soto 10.02.2025 165 1 2 Project Budget Project Partners $225,000 Gensler Architect 05/06/2026 REI Engineers Roof Design Consultant Project Name Project Description Capital Account Progress Administrative Building Reroof Project includes reroofing Progress Administrative Building. The existing roof area is approximately 15,000 square feet of stone ballast EPDM roof system and will be replaced with a 2-ply modified bituminus roof system. 40080069 PM: Simpson Progress to Completion Schedule Lead/Lag Est. Completion Date Funds Encumbered Expenses to Date Current Phase Dry Tech Roofing Contractor Construction Progress to Completion Budget Breakdown Funding Source 1 UC Capital Funds $225,000 Current Phase Roof Size 30.0%lead 07.01.2026 8%8%15,000 sf Total Revenue $225,000 Furniture/Fixed Equipment Construction Contingency $9,903 Funding Source 2 Design $34,317 Funding Source 3 Construction $99,502 Future Funding Source 1 D/C Subtotal $143,722 Future Funding Source 2 Owner Reserves Future Funding Source 3 Project Contingency Total Future Funding $0 Project Total $143,722 Schedule Breakdown 04.30.2025-06.15.2025 06.15.2025-08.15.2025 08.15.2025-4.10.2026 05.22.2026 - 07.01.2026 07.02.2026 - 07.02.2027 Unique Schedule Impacts: PreDesign Design Contracts/Bidding Construction Closeout Notes: Last Qtr REI requested revisions to the submittals from Dry Tech, submittals are still under review, expecting to start construction on 5/22/26 Next Qtr Start construction 166 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-350 Agenda Date:6/16/2026 TITLE:..title Drought Status - Update INFORMATION CONTACT: Aubrey Lofton, UC Water - Planning & Resource Management, Director, 704-296-4241 ACTION REQUESTED: None. PRIOR BOARD ACTIONS: None. BACKGROUND: Union County Water is closely following the current drought. Union County Water declared Stage 2 Drought Restrictions on May 15 to comply with the Catawba-Wateree Drought Management Advisory Group’s status change based on the Low Inflow Protocol triggers. Attached are the updated Low Inflow Protocol triggers as of June 1, 2026 and the US Drought Monitor as of June 4, 2026. FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™167 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-336 Agenda Date:6/16/2026 TITLE:..title Consider Amendment to Conveyance of County Owned Property in Union County Industrial Park (Project Canopy) INFORMATION CONTACT: Ron Mahle, Economic Development, Director, 980-476-5279 ACTION REQUESTED: 1) Adopt the Resolution for the Conveyance of County Property to McGee Corporation for Economic Development Pursuant to N.C.G.S. §158-7.1; and 2) Authorize the County Manager to i) negotiate and execute any documentation and agreement substantially consistent with this agenda item and necessary to effectuate such sale, ii) exercise any extension term options set forth in the Agreement, and iii) terminate the Agreement if deemed in the best interest of the County, each in the County Manager’s discretion. PRIOR BOARD ACTIONS: 1) October 20, 2025, Regular Meeting, Agenda Item #25-624 - Public Hearing Conducted for consideration of Step 4 Economic Development Incentive Grant to McGee Corporation 2) October 20, 2025, Regular Meeting, Agenda Item #25-626 - Step 4 Economic Development Incentive Grant was awarded to McGee Corporation in an amount-not-to-exceed $696,00 paid over a 5-year period beginning in FY 2028 3) December 8, 2025, Regular Meeting, Agenda Item #25-748 - Public Hearing Conducted on conveyance of real property 4) December 8, 2025, Regular Meeting, Agenda Item #25-749 - Consideration of conveyance of county owned property BACKGROUND: The Union County Economic Development Department started conversations with McGee Corporation under codename Project Canopy in late 2024 about the potential relocation of their manufacturing operation from Stallings, North Carolina, to a 60.97-acre parcel located off Goldmine Road. The company originally submitted an offer of $4,267,900, being $70,000 per acre. The land sought by the company was previously acquired by Union County for an industrial park or to be held for resale for industrial or commercial use, for an industrial or commercial project, pursuant to G.S. 158-7.1(the specific parcel considered for sale is Union County Tax Parcel #09372003D). McGee Corporation’s purchase of this land is in concert with the County’s economic development objectives, which are the stimulation of the local economy, growth of the tax base, promotion of business, and creation of job opportunities within Union County. The original Real Estate Purchase and Sale Agreement was signed on January 20, 2026, for the purchase price of $4,267,900. Union County, NC Printed on 6/1/2026Page 1 of 2 powered by Legistar™168 File #:26-336 Agenda Date:6/16/2026 However, it was discovered that there exist certain conditions on approximately 2.5 acres of the property, including encroachments as well as wetlands, which have decreased the fair market value of the property and need to be addressed prior to the closing date. The price per acre has been reduced only on the affected 2.5 acres of the property. The purchase consideration is now $4,136,650.00 in cash, subject to all easements, right of ways, encroachments, and other restrictions of record, and to account of any property conditions. The Board of Commissioners has determined that the property subject to conveyance has a fair market value of $4,136,650.00. The land will be used for an industrial project with an approximate investment of $40,000,000 and the creation of 35 new jobs with a probable hourly wage of $30.28 per hour for employees on the property. McGee Corporation intends to build a new 366,000 square-foot manufacturing facility on the property which will serve as its headquarters for design, sales, manufacturing, and distribution. This sale is made pursuant to private negotiation under G.S. 158-7.1. FINANCIAL IMPACT: Union County would receive $4,136,650.00 in cash in exchange for the land. The project would also bring a prospective $40,000,000 in new capital investment and at least 35 new jobs earning a probable wage of $30.28 per hour into Union County. Union County, NC Printed on 6/1/2026Page 2 of 2 powered by Legistar™169 RESOLUTION FOR THE CONVEYANCE OF COUNTY PROPERTY TO MCGEE CORPORATION FOR ECONOMIC DEVELOPMENT PURSUANT TO N.C.G.S. § 158-7.1 WHEREAS, Union County owns approximately 89 acres of property off of Goldmine Road, near the intersection of Goldmine Road and Price Short Cut Road, in Union County, as such property may be more particularly referenced as Union County Tax Parcel #09372003D (the “Original Property”); and WHEREAS, the Original Property was previously acquired by Union County for an industrial park or to be held for resale for industrial or commercial use, pursuant to N.C.G.S. § 158-7.1; and WHEREAS, N.C.G.S. § 158-7.1 authorizes a county to convey real property by private negotiation and sale property acquired for an industrial park or held for resale for industrial or commercial use; and WHEREAS, the McGee Corporation, their subsidiary or affiliated entity, (collectively “McGee”) desires to purchase 60.97 acres of the Original Property, as such parcel is shown as Lot 2 on the attached Exhibit A (the “Property”), for industrial or commercial use, including the construction of an approximate 366,000 square foot manufacturing facility, and the purchase and installation of new production equipment; and WHEREAS, McGee’s purchase of this land is in concert with the County’s economic development objectives, which are the stimulation of the local economy, growth of the tax base, promotion of business, and creation of job opportunities within Union County; and WHEREAS, a public hearing was held on June 16, 2026, to consider whether to approve the conveyance of the Property to McGee; and WHEREAS, this Resolution supersedes and replaces the prior resolution adopted December 8, 2025; and WHEREAS, the Board of Commissioners deems it wise to convey the Property to McGee by private negotiation and sale, for the consideration noted herein, pursuant to authority set forth in N.C.G.S. § 158-7.1, along with all other applicable law. NOW, THEREFORE, the Union County Board of Commissioners resolves as follows: 1. The Board of Commissioners hereby authorizes the sale of the Property by private negotiation and sale to the McGee Corporation, their subsidiary or 170 affiliated entity, for the sum of Four Million One Hundred Thirty-Six Thousand Six Hundred and Fifty and 00/100 Dollars ($4,136,650.00). 2. The Property will be used for an industrial project and will stimulate the local economy, promote business, and result in a prospective $40,000,000 in new capital investment, and the creation of thirty-five (35) new jobs with a probable hourly wage of $30.28 per hour for employees at the Property. 3. The fair market value of the interest to be conveyed is Four Million One Hundred Thirty-Six Thousand Six Hundred and Fifty and 00/100 Dollars ($4,136,650.00), subject to all easements, right of ways, and other restrictions of record. 4. The County Manager, or his designee, is authorized to execute any and all documents necessary to convey the Property to McGee, including execution of any amendments to, and ratifications of, previous agreements and documents related to this transaction. Adopted this the 16th day of June, 2026. ATTEST: _______________________________ ______________________________________ Lynn G. West, Clerk to the Board Chair Union County Board of Commissioners 171 172 173 174 AMENDMENT TO REAL ESTATE PURCHASE AND SALE AGREEMENT This Amendment to the Real Estate Purchase and Sale Agreement (“Amendment’) is entered into by and between UNION COUNTY, a political subdivision of the State of North Carolina (“Seller”), and MCGEE CORPORATION (“Buyer”) with reference to the following facts: A. On January 20, 2026, Buyer and Seller entered into a Real Estate Purchase and Sale Agreement (“Agreement”) relating to the sale of certain property described therein; and B. Buyer and Seller desire to amend the Agreement in the manner set forth below. Wherefore, for valuable consideration, the receipt and sufficiency of which are hereby acknowledged, Buyer and Seller agree as follows: 1. All defined terms and phrases in the Agreement shall have the same meaning in this Amendment unless otherwise noted. 2. Notwithstanding any provision in the Agreement to the contrary, the Buyer and Seller agree to modify the Purchase Price from Four Million Two Hundred Sixty-Seven Thousand Nine Hundred and 00/100 Dollars ($4,267,900.00) to Four Million One Hundred Thirty-Six Thousand Six Hundred Fifty and 00/100 ($4,136,650.00). 3. Section 2.5.3 of the Agreement acknowledges the existence of encroachments shown on the Exhibit Map and further states Seller will remove or otherwise remedy such encroachments prior to Closing. The parties agree that the reduction in the Purchase Price will function as a remedy to existence of the encroachments seen on the Exhibit Map. Further, the Property will be sold subject to the encroachments seen on the Exhibit Map, and the Seller shall have no further responsibility or liability for such encroachments. 4. This Amendment may be executed in counterparts and delivered by way of facsimile, email or Docusign. 5. Except as expressly modified herein, the Agreement shall remain unchanged and in full force and effect. NO FURTHER TEXT APPEARS ON THIS PAGE 175 IN WITNESS WHEREOF, the parties have executed this Amendment as of the last date of execution below. BUYER: MCGEE CORPORATION By:______________________________________ Name:___________________________________ Its:______________________________________ Date: ____________________________________ SELLER: UNION COUNTY By:______________________________________ Name:___________________________________ Its:______________________________________ Date: ____________________________________ 176 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-338 Agenda Date:6/16/2026 TITLE:..title 2025 Critical Intersection Program Design and Cost Estimation Study Approval INFORMATION CONTACT: Bjorn E. Hansen, Planning Department, Senior Planner - Long Range Planning, 704-283-3690 ACTION REQUESTED: Approve recommended designs for five intersections in study. PRIOR BOARD ACTIONS: 1) October 21, 2024, Regular Meeting, Agenda Item #24-644 - Authorized staff to apply for CRTPO grant 2) June 2, 2025, Regular Meeting, Agenda Item #25-329 - Authorized interlocal agreements with participating municipalities BACKGROUND: Union County, in partnership with Indian Trail, Monroe, Unionville and Wesley Chapel, has completed the design and cost estimation work for five intersections identified in the 2023 Critical Intersection Analysis. The intersections are: ·Unionville- Indian Trail Road at Unionville Brief and East CJ Thomas (Unionville) ·Lancaster and Bragg (Monroe) ·New Town and Lester Davis (Wesley Chapel) ·Old Charlotte and Hayes/Faircroft (Indian Trail) ·NC 84 and Willoughby The County, municipalities, NCDOT, and CRTPO met from October 2025 through May 2026 to analyze conditions, evaluate options, develop designs, engage the public, and identify a recommended design and cost. The public was consulted in March with virtual community meetings and online survey. The four municipalities have approved the designs within their boundaries. The intersection of NC 84 and Willoughby is the only intersection in unincorporated Union County. Approval does not commit Union County to funding the recommended improvements. The designs and cost estimates may be used by the County, municipalities, and NCDOT in future grant applications for implementation. FINANCIAL IMPACT: Union County, NC Printed on 6/1/2026Page 1 of 2 powered by Legistar™177 File #:26-338 Agenda Date:6/16/2026 None. Union County, NC Printed on 6/1/2026Page 2 of 2 powered by Legistar™178 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-337 Agenda Date:6/16/2026 TITLE:..title Proclamation - America 250 Month INFORMATION CONTACT: Liz Cooper, Public Communications, Director, 704-283-3587 ACTION REQUESTED: Adopt Proclamation recognizing July 2026 as America 250 Month in Union County. PRIOR BOARD ACTIONS: None. BACKGROUND: On July 4, 2026, our nation will celebrate the 250th anniversary of this historic event, known nationwide as “America 250.” This proclamation recognizes the 250th anniversary of the signing of the Declaration of Independence on July 4, 1776, and encourages residents to reflect on the nation's founding principles of liberty, equality, and democracy. It also highlights Union County's contributions to the history of North Carolina and the United States, while encouraging participation in local commemorative events and activities that honor our shared history, promote civic engagement, and foster community pride and unity. FINANCIAL IMPACT: None. Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™179 Union County, NC Staff Report Union County Government Center 500 North Main Street Monroe, North Carolina www.unioncountync.gov File #:26-341 Agenda Date:6/16/2026 TITLE:..title Appointments to Boards and Committees INFORMATION CONTACT: Lynn G. West, Clerk to the Board, 704-283-3853 ACTION REQUESTED: Appoint members PRIOR BOARD ACTIONS: None BACKGROUND: Click or tap here to enter text. FINANCIAL IMPACT: None Union County, NC Printed on 6/1/2026Page 1 of 1 powered by Legistar™180